Novus Biologicals products are now on bio-techne.com

GAK Recombinant Protein Antigen

Images

 
There are currently no images for GAK Protein (NBP1-86389PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GAK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAK.

Source: E. coli

Amino Acid Sequence: ITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GAK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86389.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GAK Recombinant Protein Antigen

  • Auxillin 2
  • cyclin G associated kinase
  • cyclin-G-associated kinase
  • EC 2.7.11.1
  • FLJ16629
  • FLJ40395
  • GAK
  • MGC99654

Background

In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92649
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
NBP1-81507
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-25162
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
AF4736
Species: Hu
Applications: WB
NB300-268
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP1-84110
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00080055-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB6598
Species: Hu, Mu, Rt
Applications: WB
NB300-206
Species: Ba, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP3-12546
Species: Hu
Applications: IHC-P, IP, WB
NBP1-48021
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-86389PEP
Species: Hu
Applications: AC

Publications for GAK Protein (NBP1-86389PEP) (0)

There are no publications for GAK Protein (NBP1-86389PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAK Protein (NBP1-86389PEP) (0)

There are no reviews for GAK Protein (NBP1-86389PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GAK Protein (NBP1-86389PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GAK Products

Array NBP1-86389PEP

Research Areas for GAK Protein (NBP1-86389PEP)

Find related products by research area.

Blogs on GAK

There are no specific blogs for GAK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GAK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GAK