Recombinant Human GAK GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GAK GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 151-250 of Human GAK

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GAK
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GAK GST (N-Term) Protein

  • Auxillin 2
  • cyclin G associated kinase
  • cyclin-G-associated kinase
  • EC 2.7.11.1
  • FLJ16629
  • FLJ40395
  • GAK
  • MGC99654

Background

GAK - cyclin G associated kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81507
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
AF4736
Species: Hu
Applications: WB
NB300-268
Species: Hu, Mu, Bv, Ce, I, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-84110
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP, ICC
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6598
Species: Hu, Mu, Rt
Applications: WB
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IHC-P, IP
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC

Publications for GAK Partial Recombinant Protein (H00002580-Q01) (0)

There are no publications for GAK Partial Recombinant Protein (H00002580-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAK Partial Recombinant Protein (H00002580-Q01) (0)

There are no reviews for GAK Partial Recombinant Protein (H00002580-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAK Partial Recombinant Protein (H00002580-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional GAK Products

Array H00002580-Q01

Bioinformatics Tool for GAK Partial Recombinant Protein (H00002580-Q01)

Discover related pathways, diseases and genes to GAK Partial Recombinant Protein (H00002580-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAK Partial Recombinant Protein (H00002580-Q01)

Discover more about diseases related to GAK Partial Recombinant Protein (H00002580-Q01).
 

Pathways for GAK Partial Recombinant Protein (H00002580-Q01)

View related products by pathway.

PTMs for GAK Partial Recombinant Protein (H00002580-Q01)

Learn more about PTMs related to GAK Partial Recombinant Protein (H00002580-Q01).
 

Research Areas for GAK Partial Recombinant Protein (H00002580-Q01)

Find related products by research area.

Blogs on GAK

There are no specific blogs for GAK, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

LRRK2 Antibody
NB300-268

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GAK GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GAK