GADD34 Antibody

Images

 
Immunohistochemistry: GADD34 Antibody [NBP1-89800] - Staining of human pancreas shows strong cytoplasmic positivity in both exocrine glandular cells and islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GADD34 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCP
Localization
Endoplasmic reticulum
Marker
ER Stress Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R15A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended
Theoretical MW
74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
GADD34 Protein (NBP1-89800PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GADD34 Antibody

  • GADD34Growth arrest and DNA damage-inducible protein GADD34
  • growth arrest and DNA-damage-inducible 34
  • Myeloid differentiation primary response protein MyD116 homolog
  • protein phosphatase 1 regulatory subunit 15A
  • protein phosphatase 1, regulatory (inhibitor) subunit 15A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF5510
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NLS1071
Species: Hu
Applications: IHC-P
AF1543
Species: Hu
Applications: WB, IHC
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87990
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-89800
Species: Hu
Applications: IHC, IHC-P

Publications for GADD34 Antibody (NBP1-89800) (0)

There are no publications for GADD34 Antibody (NBP1-89800).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GADD34 Antibody (NBP1-89800) (0)

There are no reviews for GADD34 Antibody (NBP1-89800). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GADD34 Antibody (NBP1-89800) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GADD34 Products

Bioinformatics Tool for GADD34 Antibody (NBP1-89800)

Discover related pathways, diseases and genes to GADD34 Antibody (NBP1-89800). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GADD34 Antibody (NBP1-89800)

Discover more about diseases related to GADD34 Antibody (NBP1-89800).
 

Pathways for GADD34 Antibody (NBP1-89800)

View related products by pathway.

PTMs for GADD34 Antibody (NBP1-89800)

Learn more about PTMs related to GADD34 Antibody (NBP1-89800).
 

Research Areas for GADD34 Antibody (NBP1-89800)

Find related products by research area.

Blogs on GADD34

There are no specific blogs for GADD34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GADD34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R15A
Entrez
Uniprot