Gabpb2 Antibody

Images

 
Western Blot: Gabpb2 Antibody [NBP1-81132] - Analysis in control (vector only transfected HEK293T lysate) and GABPB2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: Gabpb2 Antibody [NBP1-81132] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Gabpb2 Antibody [NBP1-81132] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gabpb2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKSAFDIALEKNNAEILVILQEAMQNQVNVNPERANPVTDPVSMAAPFIFTSGEVVNLASLISSTNTKTTSGDPHASTVQFSNSTTS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABPB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Gabpb2 Protein (NBP1-81132PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Gabpb2 Antibody

  • GA binding protein transcription factor, beta subunit 2
  • GA-binding protein subunit beta-2
  • GABP subunit beta-2
  • GABPB-2
  • MGC29891

Background

Gabpb2 encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002551-M03
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
H00002553-B01P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-71648
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93792
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
H00003131-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, WB
NBP3-10499
Species: Hu
Applications: IHC, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16249
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP1-81132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Gabpb2 Antibody (NBP1-81132) (0)

There are no publications for Gabpb2 Antibody (NBP1-81132).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gabpb2 Antibody (NBP1-81132) (0)

There are no reviews for Gabpb2 Antibody (NBP1-81132). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Gabpb2 Antibody (NBP1-81132) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gabpb2 Products

Bioinformatics Tool for Gabpb2 Antibody (NBP1-81132)

Discover related pathways, diseases and genes to Gabpb2 Antibody (NBP1-81132). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gabpb2 Antibody (NBP1-81132)

Discover more about diseases related to Gabpb2 Antibody (NBP1-81132).
 

Pathways for Gabpb2 Antibody (NBP1-81132)

View related products by pathway.

Blogs on Gabpb2

There are no specific blogs for Gabpb2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gabpb2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABPB2
Entrez
Uniprot