Gabpb2 Antibody - BSA Free

Western Blot: Gabpb2 Antibody [NBP1-81132] - Analysis in control (vector only transfected HEK293T lysate) and GABPB2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: Gabpb2 Antibody [NBP1-81132] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: Gabpb2 Antibody [NBP1-81132] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Gabpb2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Gabpb2 Antibody - BSA Free (NBP1-81132) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DKSAFDIALEKNNAEILVILQEAMQNQVNVNPERANPVTDPVSMAAPFIFTSGEVVNLASLISSTNTKTTSGDPHASTVQFSNSTTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABPB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Gabpb2 Protein (NBP1-81132PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Gabpb2 Antibody - BSA Free

• GA binding protein transcription factor, beta subunit 2
• GA-binding protein subunit beta-2
• GABP subunit beta-2
• GABPB-2
• MGC29891

Background

Gabpb2 encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GABPB2
• Entrez:
  • 126626(Human)
• Uniprot:
  • Q8TAK5(Human)