GABA-B R2 Antibody

Images

 
Immunohistochemistry: GABA-B R2 Antibody [NBP1-89803] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GABA-B R2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABBR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GABA-B R2 Protein (NBP1-89803PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GABA-B R2 Antibody

  • G protein-coupled receptor 51
  • GABA B R2
  • GABABR2
  • GABA-BR2
  • GABA-B-R2
  • GABABR2GABA-B receptor 2
  • GABBR2
  • gamma-aminobutyric acid (GABA) B receptor, 2
  • gamma-aminobutyric acid type B receptor subunit 2
  • gb2
  • GPR51
  • GPR51GABA-B receptor, R2 subunit
  • GPRC3B
  • GPRC3BFLJ36928
  • G-protein coupled receptor 51
  • HG20HRIHFB2099

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002550-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-46198
Species: Hu
Applications: WB, IHC
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-89803
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for GABA-B R2 Antibody (NBP1-89803) (0)

There are no publications for GABA-B R2 Antibody (NBP1-89803).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-B R2 Antibody (NBP1-89803) (0)

There are no reviews for GABA-B R2 Antibody (NBP1-89803). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GABA-B R2 Antibody (NBP1-89803) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GABA-B R2 Products

Bioinformatics Tool for GABA-B R2 Antibody (NBP1-89803)

Discover related pathways, diseases and genes to GABA-B R2 Antibody (NBP1-89803). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA-B R2 Antibody (NBP1-89803)

Discover more about diseases related to GABA-B R2 Antibody (NBP1-89803).
 

Pathways for GABA-B R2 Antibody (NBP1-89803)

View related products by pathway.

PTMs for GABA-B R2 Antibody (NBP1-89803)

Learn more about PTMs related to GABA-B R2 Antibody (NBP1-89803).
 

Research Areas for GABA-B R2 Antibody (NBP1-89803)

Find related products by research area.

Blogs on GABA-B R2

There are no specific blogs for GABA-B R2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA-B R2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABBR2
Entrez