Recombinant Human GAB1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GAB1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human GAB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPPKSVK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GAB1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GAB1 Protein

  • GRB2-associated binder 1
  • GRB2-associated binding protein 1
  • GRB2-associated-binding protein 1
  • Growth factor receptor bound protein 2-associated protein 1

Background

GAB1 - GRB2-associated binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-22212
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
H00009139-M15
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4877
Species: Hu
Applications: WB
H00002549-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GAB1 Partial Recombinant Protein (H00002549-Q01) (0)

There are no publications for GAB1 Partial Recombinant Protein (H00002549-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAB1 Partial Recombinant Protein (H00002549-Q01) (0)

There are no reviews for GAB1 Partial Recombinant Protein (H00002549-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAB1 Partial Recombinant Protein (H00002549-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GAB1 Products

Bioinformatics Tool for GAB1 Partial Recombinant Protein (H00002549-Q01)

Discover related pathways, diseases and genes to GAB1 Partial Recombinant Protein (H00002549-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAB1 Partial Recombinant Protein (H00002549-Q01)

Discover more about diseases related to GAB1 Partial Recombinant Protein (H00002549-Q01).
 

Pathways for GAB1 Partial Recombinant Protein (H00002549-Q01)

View related products by pathway.

PTMs for GAB1 Partial Recombinant Protein (H00002549-Q01)

Learn more about PTMs related to GAB1 Partial Recombinant Protein (H00002549-Q01).

Blogs on GAB1.

CD19: An Undoubted Biomarker for B Cells
CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GAB1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GAB1