G5pr Antibody

Images

 
Western Blot: G5pr Antibody [NBP1-89907] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: G5pr Antibody [NBP1-89907] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G5pr Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTVTTILIDLNGFWT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R3C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
G5pr Protein (NBP1-89907PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for G5pr Antibody

  • C14orf10
  • chromosome 14 open reading frame 10
  • FLJ20644
  • G4-1
  • G5pr
  • protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma
  • protein phosphatase 2, regulatory subunit B'', gamma
  • Protein phosphatase subunit G5PR
  • rhabdomyosarcoma antigen MU-RMS-40.6A
  • Rhabdomyosarcoma antigen MU-RMS-40.6A/6C
  • rhabdomyosarcoma antigen Mu-RMS-40.6C
  • serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-83393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47927
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2545
Species: Hu
Applications: WB, IHC, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF123
Species: Hu
Applications: WB, Block, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89907
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for G5pr Antibody (NBP1-89907) (0)

There are no publications for G5pr Antibody (NBP1-89907).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G5pr Antibody (NBP1-89907) (0)

There are no reviews for G5pr Antibody (NBP1-89907). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G5pr Antibody (NBP1-89907) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G5pr Products

Bioinformatics Tool for G5pr Antibody (NBP1-89907)

Discover related pathways, diseases and genes to G5pr Antibody (NBP1-89907). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G5pr Antibody (NBP1-89907)

Discover more about diseases related to G5pr Antibody (NBP1-89907).
 

Pathways for G5pr Antibody (NBP1-89907)

View related products by pathway.

PTMs for G5pr Antibody (NBP1-89907)

Learn more about PTMs related to G5pr Antibody (NBP1-89907).

Blogs on G5pr

There are no specific blogs for G5pr, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G5pr Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R3C
Entrez
Uniprot