G gamma3 Antibody (1E10-1B5) - Azide and BSA Free

Western Blot: G gamma3 Antibody (1E10-1B5) [H00002785-M01] - GNG3 monoclonal antibody (M01), clone 1E10-1B5. Analysis of GNG3 expression in rat brain.

Sandwich ELISA: G gamma3 Antibody (1E10-1B5) [H00002785-M01] - Detection limit for recombinant GST tagged GNG3 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 1E10-1B5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

G gamma3 Antibody (1E10-1B5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GNG3 (AAH15563, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GNG3
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for G gamma3 Antibody (1E10-1B5) - Azide and BSA Free

• GNGT3
• guanine nucleotide binding protein (G protein), gamma 3
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
• guanine nucleotide-binding protein gamma-3 subunit
• NBP gamma-3

Background

G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to thespecificity of the hundreds of receptor signaling pathways involving G proteins (Schwindinger et al., 2004 (PubMed15314181)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNG3