TCP1-eta Antibody

Images

 
Western Blot: TCP1-eta Antibody [NBP1-88144] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TCP1-eta Antibody [NBP1-88144] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: TCP1-eta Antibody [NBP1-88144] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: TCP1-eta Antibody [NBP1-88144] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCP1-eta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCT7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCP1-eta Protein (NBP1-88144PEP)
Publications
Read Publications using NBP1-88144.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24213632)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCP1-eta Antibody

  • CCTETA
  • CCT-eta
  • CCTH
  • chaperonin containing TCP1, subunit 7 (eta)
  • eta subunit
  • HIV-1 Nef interacting protein
  • HIV-1 Nef-interacting protein
  • MGC110985
  • Nip7-1
  • T-complex protein 1 subunit eta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88146
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97505
Species: Hu, Mu, Rt, Po, Bv, Ce, Ca, Dr, GP, Pl, Pm, Rb, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00009468-D01P
Species: Hu
Applications: WB, ELISA
H00022948-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-88145
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
H00063940-M01
Species: Hu
Applications: WB, ELISA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88144
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TCP1-eta Antibody (NBP1-88144)(2)

Reviews for TCP1-eta Antibody (NBP1-88144) (0)

There are no reviews for TCP1-eta Antibody (NBP1-88144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCP1-eta Antibody (NBP1-88144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCP1-eta Products

Bioinformatics Tool for TCP1-eta Antibody (NBP1-88144)

Discover related pathways, diseases and genes to TCP1-eta Antibody (NBP1-88144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCP1-eta Antibody (NBP1-88144)

Discover more about diseases related to TCP1-eta Antibody (NBP1-88144).
 

Pathways for TCP1-eta Antibody (NBP1-88144)

View related products by pathway.

PTMs for TCP1-eta Antibody (NBP1-88144)

Learn more about PTMs related to TCP1-eta Antibody (NBP1-88144).
 

Research Areas for TCP1-eta Antibody (NBP1-88144)

Find related products by research area.

Blogs on TCP1-eta

There are no specific blogs for TCP1-eta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCP1-eta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCT7