Recombinant Human FXYD6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FXYD6 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 95 of Human FXYD6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FXYD6
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FXYD6 Protein

  • FXYD domain containing ion transport regulator 6
  • FXYD domain-containing ion transport regulator 6
  • phosphohippolin

Background

FXYD6( AAH18652, 1 a.a. - 96 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79193
Species: Hu
Applications: WB
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NLS6731
Species: Hu, Rt, Po, Bv, Ca, Eq, Gt, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
AF2569
Species: Hu
Applications: WB, ICC
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22238
Species: Hu, Mu
Applications: WB, IP
NBP1-83619
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP1-82268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NB100-98867
Species: Rt
Applications: WB, IHC
NBP1-69104
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88933
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5375
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
AF4538
Species: Hu, Mu, Rt
Applications: WB
NBP1-86404
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02829
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00053826-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FXYD6 Recombinant Protein (H00053826-P01) (0)

There are no publications for FXYD6 Recombinant Protein (H00053826-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXYD6 Recombinant Protein (H00053826-P01) (0)

There are no reviews for FXYD6 Recombinant Protein (H00053826-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FXYD6 Recombinant Protein (H00053826-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FXYD6 Products

Bioinformatics Tool for FXYD6 Recombinant Protein (H00053826-P01)

Discover related pathways, diseases and genes to FXYD6 Recombinant Protein (H00053826-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FXYD6 Recombinant Protein (H00053826-P01)

Discover more about diseases related to FXYD6 Recombinant Protein (H00053826-P01).
 

Pathways for FXYD6 Recombinant Protein (H00053826-P01)

View related products by pathway.

Blogs on FXYD6

There are no specific blogs for FXYD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SATB2 Antibody
NBP1-83619
FXYD6 Antibody
NBP1-91915
ASAH1 Antibody
NBP1-89296

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FXYD6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FXYD6