mu Crystallin Antibody (6B3)

Images

 
Western Blot: mu Crystallin Antibody (6B3) [H00001428-M03] - Analysis of CRYM expression in Jurkat (Cat # L017V1).
Immunohistochemistry-Paraffin: mu Crystallin Antibody (6B3) [H00001428-M03] - Analysis of monoclonal antibody to CRYM on formalin-fixed paraffin-embedded human skeletal muscle. Antibody concentration 3 ug/ml
Western Blot: mu Crystallin Antibody (6B3) [H00001428-M03] - Analysis of CRYM expression in transfected 293T cell line by CRYM monoclonal antibody (M03), clone 6B3. Lane 1: CRYM transfected lysatE (33.8 KDa). Lane 2: ...read more
Immunoprecipitation: mu Crystallin Antibody (6B3) [H00001428-M03] - Analysis of CRYM transfected lysate using anti-CRYM monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRYM rabbit polyclonal ...read more
ELISA: mu Crystallin Antibody (6B3) [H00001428-M03] - Detection limit for recombinant GST tagged CRYM is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, IP
Clone
6B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

mu Crystallin Antibody (6B3) Summary

Immunogen
CRYM (NP_001879 215 a.a. - 314 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
Specificity
CRYM (6B3)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRYM
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Positive Control
Jurkat Lysate (NB800-PC2)
Publications
Read Publications using H00001428-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for mu Crystallin Antibody (6B3)

  • crystallin, mu
  • DFNA40NADP-regulated thyroid-hormone binding protein
  • mu-crystallin homolog
  • NADP-regulated thyroid-hormone-binding protein
  • THBP

Background

Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Multiple alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87766
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-80700
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83419
Species: Hu
Applications: IHC, IHC-P
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-57033
Species: Hu
Applications: WB
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB4235
Species: Hu, Mu
Applications: WB
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-91915
Species: Hu
Applications: WB, IHC, IHC-P

Publications for mu Crystallin Antibody (H00001428-M03)(4)

Reviews for mu Crystallin Antibody (H00001428-M03) (0)

There are no reviews for mu Crystallin Antibody (H00001428-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mu Crystallin Antibody (H00001428-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional mu Crystallin Products

Bioinformatics Tool for mu Crystallin Antibody (H00001428-M03)

Discover related pathways, diseases and genes to mu Crystallin Antibody (H00001428-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mu Crystallin Antibody (H00001428-M03)

Discover more about diseases related to mu Crystallin Antibody (H00001428-M03).
 

Pathways for mu Crystallin Antibody (H00001428-M03)

View related products by pathway.

PTMs for mu Crystallin Antibody (H00001428-M03)

Learn more about PTMs related to mu Crystallin Antibody (H00001428-M03).
 

Research Areas for mu Crystallin Antibody (H00001428-M03)

Find related products by research area.

Blogs on mu Crystallin

There are no specific blogs for mu Crystallin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mu Crystallin Antibody (6B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYM
Entrez
OMIM
Uniprot