mu Crystallin Antibody (6B3) - Azide and BSA Free

Western Blot: mu Crystallin Antibody (6B3) [H00001428-M03] - Analysis of CRYM expression in transfected 293T cell line by CRYM monoclonal antibody (M03), clone 6B3. Lane 1: CRYM transfected lysatE (33.8 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: mu Crystallin Antibody (6B3) [H00001428-M03] - Analysis of monoclonal antibody to CRYM on formalin-fixed paraffin-embedded human skeletal muscle. Antibody concentration 3 ug/ml

Western Blot: mu Crystallin Antibody (6B3) [H00001428-M03] - Analysis of CRYM expression in Jurkat (Cat # L017V1).

Immunoprecipitation: mu Crystallin Antibody (6B3) [H00001428-M03] - Analysis of CRYM transfected lysate using anti-CRYM monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRYM rabbit polyclonal antibody.

ELISA: mu Crystallin Antibody (6B3) [H00001428-M03] - Detection limit for recombinant GST tagged CRYM is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC, IP
• Clone: 6B3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

mu Crystallin Antibody (6B3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CRYM (NP_001879, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
• Specificity: CRYM (6B3)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CRYM
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
• Control:

  Jurkat Whole Cell Lysate

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for mu Crystallin Antibody (6B3) - Azide and BSA Free

• crystallin, mu
• DFNA40NADP-regulated thyroid-hormone binding protein
• mu-crystallin homolog
• NADP-regulated thyroid-hormone-binding protein
• THBP

Background

Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Multiple alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for mu Crystallin Antibody (H00001428-M03)(8)

Publications using H00001428-M03

• Schnoell J, Kotowski U, Jank BJ et al. Prognostic Relevance of Thyroid-Hormone-Associated Proteins in Adenoid Cystic Carcinoma of the Head and Neck Journal of personalized medicine 2021-12-12 [PMID: 34945824]
• Bernhard J, Markus H, Julia S et al. ?-Crystallin Is Associated with Disease Outcome in Head and Neck Squamous Cell Carcinoma. J Pers Med. 2021-12-08 [PMID: 34945802]
• Christian K, Andrea O, Kaila N et al. ?-Crystallin in Mouse Skeletal Muscle Promotes a Shift from Glycolytic toward Oxidative Metabolism. Curr Res Physiol. 2021-02-09 [PMID: 34746826]
• Vanderplanck C, Tassin A, Ansseau E et al. Overexpression of the double homeodomain protein DUX4c interferes with myofibrillogenesis and induces clustering of myonuclei. Skelet Muscle 2018-01-12 [PMID: 29329560]
• Dilwali S, Lysaght A, Roberts D et al. Sporadic vestibular schwannomas associated with good hearing secrete higher levels of fibroblast growth factor 2 than those associated with poor hearing irrespective of tumor size. Otol Neurotol. 2013-06-01 [PMID: 23512073] (Human)
• Vanderplanck C, Ansseau E, Charron S et al. The FSHD Atrophic Myotube Phenotype Is Caused by DUX4 Expression. PLoS One. 2011-10-28 [PMID: 22053214]
• Mathur BN, Caprioli RM, Deutch AY. Proteomic Analysis Illuminates a Novel Structural Definition of the Claustrum Insula. Cereb Cortex :bhn253. 2009-01-01 [PMID: 19168664]
• 1 Reed PW, Corse AM, Porter NC et al. Abnormal expression of mu-crystallin in facioscapulohumeral muscular dystrophy. Exp Neurol;205(2):583-6. 2007-06-01 [PMID: 17451686]

Bioinformatics

• Gene Symbol: CRYM
• Entrez:
  • 1428(Human)
• OMIM:
  • 123740(Human)
• Uniprot:
  • NP_001879(Human)