We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FXYD5/Dysadherin Recombinant Protein Antigen

Images

 
There are currently no images for FXYD5/Dysadherin Protein (NBP1-82486PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FXYD5/Dysadherin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FXYD5.

Source: E. coli

Amino Acid Sequence: DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FXYD5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82486.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FXYD5/Dysadherin Recombinant Protein Antigen

  • DYSAD
  • Dysadherin
  • EF-8
  • FXYD domain containing ion transport regulator 5
  • FXYD domain-containing ion transport regulator 5
  • FXYD5
  • IWU1
  • KCT1
  • keratinocytes associated transmembrane protein 1
  • OIT2
  • PRO6241
  • RIC

Background

Dysadherin encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NB100-56414
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87769
Species: Hu
Applications: ICC/IF,  IHC-P
AF4117
Species: Rt
Applications: IHC, WB
NBP3-47156
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NBP2-31993
Species: Hu
Applications: IHC,  IHC-P, WB
MAB4697
Species: Hu
Applications: WB
NBP2-48725
Species: Hu
Applications: IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC,  IHC-P, ISH
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF5129
Species: Hu
Applications: WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-82486PEP
Species: Hu
Applications: AC

Publications for FXYD5/Dysadherin Protein (NBP1-82486PEP) (0)

There are no publications for FXYD5/Dysadherin Protein (NBP1-82486PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXYD5/Dysadherin Protein (NBP1-82486PEP) (0)

There are no reviews for FXYD5/Dysadherin Protein (NBP1-82486PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FXYD5/Dysadherin Protein (NBP1-82486PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FXYD5/Dysadherin Products

Research Areas for FXYD5/Dysadherin Protein (NBP1-82486PEP)

Find related products by research area.

Blogs on FXYD5/Dysadherin

There are no specific blogs for FXYD5/Dysadherin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FXYD5/Dysadherin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FXYD5