FXR2 Antibody - BSA Free

Western Blot: FXR2 Antibody [NBP3-03964] - Analysis of extracts of various cell lines, using FxR2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

Western Blot: FXR2 Antibody - BSA Free [FXR2] - Western blot analysis of various lysates using FXR2 Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 20s.

Immunocytochemistry/ Immunofluorescence: FXR2 Antibody - BSA Free [FXR2] - Immunofluorescence analysis of U2OS cells using FXR2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FXR2 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human FXR2 (NP_004851.2). RRRTDEDRTVMDGGLESDGPNMTENGLEDESRPQRRNRSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSVSKLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FXR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FXR2 Antibody - BSA Free

• FMR1L2
• fragile X mental retardation syndrome-related protein 2
• fragile X mental retardation, autosomal homolog 2
• fragile X-mental retardation 1-like 2
• FXR2P

Background

Fragile X mental retardation syndrome-related protein 2 (FXR2) is an RNA binding protein that predominantly associates with polyribosomes. Fragile X syndrome is caused by the absence of the fragile X mental-retardation protein, the archetype of a class of cytoplasmic mRNA-binding proteins that includes both the fragile X-related 1 and 2 proteins (FXR1 and FXR2). The fragile X-related proteins FXR1 and FXR2 contain a functional nucleolar-targeting signal equivalent to the HIV-1 regulatory proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FXR2