FTSJD2 Antibody - BSA Free

Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83047] - Analysis in human testis and liver tissues. Corresponding CMTR1 RNA-seq data are presented for the same tissues.

Western Blot: FTSJD2 Antibody [NBP1-83047] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: FTSJD2 Antibody [NBP1-83047] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83047] - Staining of human placenta shows strong nuclear and nucleolar positivity in trophoblastic cells.

Western Blot: FTSJD2 Antibody [NBP1-83047] - Analysis in human cell line U-138MG.

Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83047] - Staining of human duodenum shows strong nucleolar positivity in glandular cells.

Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83047] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts and Leydig cells.

Immunohistochemistry-Paraffin: FTSJD2 Antibody [NBP1-83047] - Staining of human liver shows weak nucleolar positivity in hepatocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FTSJD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FTSJD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FTSJD2 Protein (NBP1-83047PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FTSJD2 Antibody - BSA Free

• Cap1 2'O-ribose methyltransferase 1
• cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
• EC 2.1.1.57
• FtsJ methyltransferase domain containing 2
• FtsJ methyltransferase domain-containing protein 2
• hMTr1
• Interferon-stimulated gene 95 kDa protein
• ISG95
• KIAA0082FLJ22156
• MTR1
• S-adenosyl-L-methionine-dependent methyltransferase FTSJD2

Background

KIAA0082 was first identified as a hypothetical protein predicted from the in silico analysis of long cDNAs isolated in the Kazusa cDNA sequencing project. KIAA0082 contains a G-patch and WW domain and several predicted phosphoserine sites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FTSJD2 Antibody (NBP1-83047)(1)

Publication using NBP1-83047

• Bergant V, Yamada S, Grass V et al. Attenuation of SARS-CoV-2 replication and associated inflammation by concomitant targeting of viral and host cap 2'-O-ribose methyltransferases The EMBO journal 2022-07-14 [PMID: 35833542] (WB, Human)
  
  Details:
  1:1000 dilution

Bioinformatics

• Gene Symbol: FTSJD2