Home » FTS » FTS Antibodies » FTS Antibody

FTS Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: FTS Antibody [NBP1-53106] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.
Western Blot: FTS Antibody [NBP1-53106] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FTS Antibody Summary

Immunogen
Synthetic peptides corresponding to AKTIP(AKT interacting protein) The peptide sequence was selected from the middle region of AKTIP. Peptide sequence NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKTIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against AKTIP and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FTS Antibody

  • AKT interacting protein
  • AKT-interacting protein
  • FLJ13258
  • FT1
  • FTSfused toes homolog (mouse)
  • fused toes (mouse) homolog
  • fused toes homolog
  • Fused toes protein homolog

Background

AKTIP is the component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). AKTIP regulates apoptosis by enhancing phosphorylation and activation of AKT1. AKTIP increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade.The mouse homolog of this gene produces fused toes and thymic hyperplasia in heterozygous mutant animals while homozygous mutants die in early development. This gene may play a role in apoptosis as these morphological abnormalities are caused by altered patterns of programmed cell death. The protein encoded by this gene is similar to the ubiquitin ligase domain of other ubiquitin-conjugating enzymes but lacks the conserved cysteine residue that enables those enzymes to conjugate ubiquitin to the target protein. This protein interacts directly with serine/threonine kinase protein kinase B (PKB)/Akt and modulates PKB activity by enhancing the phosphorylation of PKB's regulatory sites. Alternative splicing results in two transcript variants encoding the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(26 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(36 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Thymopoietin/LAP2
Antibody
NBP1-87822
Immunocytochemistry/Immunofluorescence: Thymopoietin/LAP2 Antibody [NBP1-87822] - Staining of human cell line A-431 shows localization to nuclear membrane. Antibody staining is shown in green.
Western Blot: Thymopoietin/LAP2 Antibody [NBP1-87822] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-TMPO antibody. Remaining relative intensity is presented.
Western Blot: Thymopoietin/LAP2 Antibody [NBP1-87822] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(26 Reviews)
(333 Publications)
Species: Hu
Applications: BA
HRAS Antibody
NBP2-42864
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HRAS antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-RAS antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-Ras antibody diluted at 1:5000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(702 Publications)
Species: Hu
Applications: BA
Raf-1 Antibody
(563002)
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Used at 5 ug/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate staining of proximal convoluted tubules of the kidney. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain.
Western Blot: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Detection of a 250 kDa band (indicated) corresponding to phosphorylated human mTOR present in a 293T whole cell lysates. Cells were serum-starved for 24 hours prior to harvest. 20 ug of lysate was loaded per lane for SDS-PAGE. Untreated cells are shown in lane 1, whereas cells in lane 2 were treated with IGF-1 (100 ng/ml) for 20 min prior to harvest. Follow reaction of antibody with a 1:2000 dilution of HRP Goat-a-Rabbit IgG for visualization.
Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(26 Reviews)
(577 Publications)
Species: Hu
Applications: BA
p130 Antibody
NBP1-82455
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells and cells in granular and molecular layer.
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human endometrium shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Pappalysin-1/PAPP-A [H
DPPA00
(4 Publications)
Species: Hu
Applications: ELISA
Thymidylate
Synthase Antibody (SP
NBP2-34390
Flow (Intracellular): Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - An intracellular stain was performed on HEK293 cells with Thymidylate Synthase Antibody [SPM453] NBP2-34441PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the Azide and BSA Free format of this antibody.
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - Formalin-fixed, paraffin-embedded human Testicular Carcinoma stained with Thymidylate Synthase Antibody (SPM453).
Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody (SPM453) [NBP2-34390] - Formalin-fixed, paraffin-embedded human testicular carcinoma stained with Thymidylate Synthase Mouse Monoclonal Antibody (SPM453).
(1 Review)
Species: Hu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(28 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
FTS Antibody
NBP1-53106
FTS Antibody
Species: Hu
Applications: WB

Publications for FTS Antibody (NBP1-53106) (0)

There are no publications for FTS Antibody (NBP1-53106).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FTS Antibody (NBP1-53106) (0)

There are no reviews for FTS Antibody (NBP1-53106). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FTS Antibody (NBP1-53106) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FTS Products

Bioinformatics Tool for FTS Antibody (NBP1-53106)

Discover related pathways, diseases and genes to FTS Antibody (NBP1-53106). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FTS Antibody (NBP1-53106)

Discover more about diseases related to FTS Antibody (NBP1-53106).
 

Pathways for FTS Antibody (NBP1-53106)

View related products by pathway.

PTMs for FTS Antibody (NBP1-53106)

Learn more about PTMs related to FTS Antibody (NBP1-53106).
 

Research Areas for FTS Antibody (NBP1-53106)

Find related products by research area.

Blogs on FTS

There are no specific blogs for FTS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FTS Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AKTIP
Uniprot