FTO Antibody


Western Blot: FTO Antibody [NBP2-58941] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941] - Staining in human parathyroid gland and pancreas tissues using anti-FTO antibody. Corresponding FTO RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941] - Staining of human parathyroid gland shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

FTO Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP
Specificity of human FTO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FTO Recombinant Protein Antigen (NBP2-58941PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FTO Antibody

  • Alpha-ketoglutarate-dependent dioxygenase FTO
  • EC 1.14.11.-
  • fat mass and obesity associated
  • Fat mass and obesity-associated protein
  • FTO
  • KIAA1752protein fto
  • MGC5149


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FTO Antibody (NBP2-58941) (0)

There are no publications for FTO Antibody (NBP2-58941).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FTO Antibody (NBP2-58941) (0)

There are no reviews for FTO Antibody (NBP2-58941). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FTO Antibody (NBP2-58941). (Showing 1 - 1 of 1 FAQ).

  1. Do you have any antibodies against FTO, where you can indicate the sequence of the immunogen?
    • With regards to other FTO antibodies that we do list the peptide sequence for, the immunogen sequence for catalog number NB110-60935 can be found in the range of amino acids 400-505. Many of the exact immunogen sequences used for our products are proprietary and cannot be disclosed. In these instances we try to provide a reasonable amino acid range to help in your decision.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for FTO Antibody (NBP2-58941)

Discover related pathways, diseases and genes to FTO Antibody (NBP2-58941). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FTO Antibody (NBP2-58941)

Discover more about diseases related to FTO Antibody (NBP2-58941).

Pathways for FTO Antibody (NBP2-58941)

View related products by pathway.

PTMs for FTO Antibody (NBP2-58941)

Learn more about PTMs related to FTO Antibody (NBP2-58941).

Research Areas for FTO Antibody (NBP2-58941)

Find related products by research area.

Blogs on FTO

There are no specific blogs for FTO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FTO Antibody and receive a gift card or discount.


Gene Symbol FTO