FTO Antibody - BSA Free

Western Blot: FTO Antibody [NBP2-58941] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941] - Staining in human parathyroid gland and pancreas tissues using anti-FTO antibody. Corresponding FTO RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: FTO Antibody [NBP2-58941] - Staining of human parathyroid gland shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FTO Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FTO
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FTO Recombinant Protein Antigen (NBP2-58941PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FTO Antibody - BSA Free

• Alpha-ketoglutarate-dependent dioxygenase FTO
• EC 1.14.11.-
• fat mass and obesity associated
• Fat mass and obesity-associated protein
• FTO
• KIAA1752protein fto
• MGC5149

Background

Fat mass and obesity-associated protein (FTO) is a novel protein and a member of the non-heme dioxygenase (Fe(II)- and 2-oxoglutarate-dependent dioxygenases) superfamily. Though not much is yet known about FTO, it is thought that the protein may somehow modify the activity of genes involved in metabolism and fat storage, which in turn may influence a person's risk of obesity.

FTO antibodies are useful tools for lipid metabolism research and obesity studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for FTO Antibody (NBP2-58941). (Showing 1 - 1 of 1 FAQ).

1. Do you have any antibodies against FTO, where you can indicate the sequence of the immunogen?
   • With regards to other FTO antibodies that we do list the peptide sequence for, the immunogen sequence for catalog number NB110-60935 can be found in the range of amino acids 400-505. Many of the exact immunogen sequences used for our products are proprietary and cannot be disclosed. In these instances we try to provide a reasonable amino acid range to help in your decision.

Bioinformatics

• Gene Symbol: FTO