FRMD6 Antibody

Images

 
Western Blot: FRMD6 Antibody [NBP2-84033] - Host: Rabbit. Target Name: Frmd6. Sample Type: Rat Stomach lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Rt, Hu, Mu, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FRMD6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat FRMD6. Peptide sequence: PQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHE The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Mouse (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%), Canine (100%), Equine (92%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
FRMD6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FRMD6 Antibody

  • FERM domain containing 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75520
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00139324-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-86860
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67584
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
NBP1-31233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP3-03913
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88861
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP2-84033
Species: Rt, Hu, Mu, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for FRMD6 Antibody (NBP2-84033) (0)

There are no publications for FRMD6 Antibody (NBP2-84033).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRMD6 Antibody (NBP2-84033) (0)

There are no reviews for FRMD6 Antibody (NBP2-84033). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FRMD6 Antibody (NBP2-84033) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FRMD6 Products

Array NBP2-84033

Bioinformatics Tool for FRMD6 Antibody (NBP2-84033)

Discover related pathways, diseases and genes to FRMD6 Antibody (NBP2-84033). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRMD6 Antibody (NBP2-84033)

Discover more about diseases related to FRMD6 Antibody (NBP2-84033).
 

Pathways for FRMD6 Antibody (NBP2-84033)

View related products by pathway.

PTMs for FRMD6 Antibody (NBP2-84033)

Learn more about PTMs related to FRMD6 Antibody (NBP2-84033).

Blogs on FRMD6

There are no specific blogs for FRMD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FRMD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FRMD6