Frk Recombinant Protein Antigen

Images

 
There are currently no images for Frk Recombinant Protein Antigen (NBP2-68617PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Frk Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Frk.

Source: E.coli

Amino Acid Sequence: RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FRK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68617. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Frk Recombinant Protein Antigen

  • EC 2.7.10
  • Frk
  • fyn-related kinaseProtein-tyrosine kinase 5
  • Gtk
  • GTKEC 2.7.10.2
  • Nuclear tyrosine protein kinase RAK
  • PTK5 protein tyrosine kinase 5
  • PTK5
  • Rak
  • RAKPTK5
  • tyrosine-protein kinase FRK

Background

The protein encoded by the FRK gene belongs to the TYR family of protein kinases. This tyrosine kinase is a nuclearprotein and may function during G1 and S phase of the cell cycle and suppress growth. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF7817
Species: Hu, Mu, Rt
Applications: WB
MAB541
Species: Hu, Rt
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31650
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DY1857
Species: Mu
Applications: ELISA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
H00008814-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP1-88792
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-91214
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
MAB7500
Species: Hu
Applications: ICC, WB
NB100-79781
Species: Hu
Applications: IHC, IHC-P, IP, WB

Publications for Frk Recombinant Protein Antigen (NBP2-68617PEP) (0)

There are no publications for Frk Recombinant Protein Antigen (NBP2-68617PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frk Recombinant Protein Antigen (NBP2-68617PEP) (0)

There are no reviews for Frk Recombinant Protein Antigen (NBP2-68617PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Frk Recombinant Protein Antigen (NBP2-68617PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Frk Products

Array NBP2-68617PEP

Bioinformatics Tool for Frk Recombinant Protein Antigen (NBP2-68617PEP)

Discover related pathways, diseases and genes to Frk Recombinant Protein Antigen (NBP2-68617PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frk Recombinant Protein Antigen (NBP2-68617PEP)

Discover more about diseases related to Frk Recombinant Protein Antigen (NBP2-68617PEP).
 

Pathways for Frk Recombinant Protein Antigen (NBP2-68617PEP)

View related products by pathway.

PTMs for Frk Recombinant Protein Antigen (NBP2-68617PEP)

Learn more about PTMs related to Frk Recombinant Protein Antigen (NBP2-68617PEP).
 

Research Areas for Frk Recombinant Protein Antigen (NBP2-68617PEP)

Find related products by research area.

Blogs on Frk

There are no specific blogs for Frk, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Frk Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FRK