Frizzled-6 Antibody

Images

 
Western Blot: Frizzled-6 Antibody [NBP1-69468] - This Anti-FZD6 antibody was used in Western Blot of ACHN tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Frizzled-6 Antibody Summary

Immunogen
Synthetic peptides corresponding to FZD6(frizzled homolog 6 (Drosophila)) The peptide sequence was selected from the middle region of FZD6. Peptide sequence HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FZD6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FZD6 and was validated on Western blot.
Theoretical MW
79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Frizzled-6 Antibody

  • frizzled (Drosophila) homolog 6
  • frizzled homolog 6 (Drosophila)
  • Frizzled6
  • Frizzled-6
  • FZ6
  • fz-6
  • FZD6
  • Hfz6
  • seven transmembrane helix receptor

Background

This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The protein encoded by this family member contains a signal peptide, a cysteine-rich domain in the N-t

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
AF1120
Species: Mu
Applications: WB, IHC
MAB1001
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready
645-WN/CF
Species: Hu, Mu
AF1617
Species: Hu
Applications: WB
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF198
Species: Mu
Applications: WB, IHC
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NB100-2439
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
AF475
Species: Mu
Applications: WB, IHC
NBP2-23659
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7164
Species: Hu
Applications: WB
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
3900-WN/CF
Species: Mu
NBP1-69468
Species: Hu
Applications: WB

Publications for Frizzled-6 Antibody (NBP1-69468) (0)

There are no publications for Frizzled-6 Antibody (NBP1-69468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frizzled-6 Antibody (NBP1-69468) (0)

There are no reviews for Frizzled-6 Antibody (NBP1-69468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Frizzled-6 Antibody (NBP1-69468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Frizzled-6 Products

Bioinformatics Tool for Frizzled-6 Antibody (NBP1-69468)

Discover related pathways, diseases and genes to Frizzled-6 Antibody (NBP1-69468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-6 Antibody (NBP1-69468)

Discover more about diseases related to Frizzled-6 Antibody (NBP1-69468).
 

Pathways for Frizzled-6 Antibody (NBP1-69468)

View related products by pathway.

PTMs for Frizzled-6 Antibody (NBP1-69468)

Learn more about PTMs related to Frizzled-6 Antibody (NBP1-69468).
 

Research Areas for Frizzled-6 Antibody (NBP1-69468)

Find related products by research area.

Blogs on Frizzled-6

There are no specific blogs for Frizzled-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frizzled-6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FZD6
Entrez
Uniprot