Home » Frizzled-10 » Frizzled-10 Proteins » Frizzled-10 Recombinant Protein Antigen

Frizzled-10 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Frizzled-10 Protein (NBP1-85754PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Frizzled-10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FZD10.

Source: E.coli

Amino Acid Sequence: ERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASI
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FZD10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-85754.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Frizzled-10 Recombinant Protein Antigen

  • CD350 antigen
  • CD350
  • frizzled (Drosophila) homolog 10
  • frizzled homolog 10 (Drosophila)
  • Frizzled10
  • Frizzled-10
  • Fz10
  • Fz-10
  • FZD10
  • FzE7
  • hFz10

Background

Frizzled-10 (FZD10) is a Frizzled Receptor that mediates Wnt signaling. It is expressed during development in embryonic limbs, neural tube, and central nervous system. FZD10 has been reported to be expressed in brain, embryo, kidney, liver, lung, pancreas, placenta, skeletal muscle, spinal cord, and testis. ESTs have been isolated from brain, ear, heart/melanocyte/uterus, and kidney libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Frizzled-9
Antibody - BSA Free
NLS5103
Immunohistochemistry-Paraffin: Frizzled-9 Antibody [NLS5103] - Analysis of anti-FZD9 / Frizzled 9 antibody with brain, Purkinje neurons at 13 ug/ ml.
Immunohistochemistry-Paraffin: Frizzled-9 Antibody [NLS5103] - Analysis of anti-FZD9 / Frizzled 9 antibody with human brain, glioblastoma.
Immunohistochemistry-Paraffin: Frizzled-9 Antibody [NLS5103] - Anti-FZD9 / Frizzled 9 antibody IHC of human Pancreas, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Bv, Ca, Hu
Applications: ICC, IHC, IHC-P
Frizzled-1 Antibody
AF1120
Frizzled‑1 was detected in immersion fixed frozen sections of embryonic mouse intestine (13 d.p.c.) using 15 µg/mL Goat Anti-Mouse Frizzled‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1120) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the plasma membrane of epithelial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(3 Publications)
Species: Mu
Applications: IHC, WB
Frizzled-5 Antibody
AF1617
Frizzled-5 Antibody
(8 Publications)
Species: Hu
Applications: WB
Frizzled-4
Antibody (145901)
MAB194
Frizzled-4 Antibody (145901)
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Frizzled-7
Antibody [Unconjugate
AF198
Frizzled‑7 was detected in immersion fixed frozen sections of embryonic mouse gastrointestinal tract (11 d.p.c.) using 15 µg/mL Goat Anti-Mouse Frizzled‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF198) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse Frizzled‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF198) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Frizzled‑7 at approximately 65 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(5 Publications)
Species: Mu
Applications: IHC, WB
Frizzled-3
Antibody [Unconjugate
AF1001
Frizzled‑3 was detected in immersion fixed frozen sections of mouse embryo (E11) using Mouse Frizzled‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1001) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(5 Publications)
Species: Mu
Applications: IHC
Frizzled-2 Antibody
NBP1-20920
Western Blot: Frizzled-2 Antibody [NBP1-20920] - (0.03ug/ml) staining of Human Heart (A) and (0.1ug/ml) Placenta (B) lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Frizzled-2 Antibody [NBP1-20920] - Analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear and cytoplasmic staining. Actin filaments were stained with phalloidin (red). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
Immunohistochemistry-Paraffin: Frizzled-2 Antibody [NBP1-20920] - Staining of paraffin embedded human liver. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Frizzled-8
6129-FZ
Frizzled-8
(4 Publications)
Species: Hu
Applications: BA, GelChrom
Frizzled-6 Antibody
AF1526
Frizzled-6 Antibody
(9 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(19 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH/CF
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog #1845-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
(56 Publications)
Species: Hu
Applications: BA
Wnt-7a Antibody
NBP2-20913
Western Blot: Wnt-7a Antibody [NBP2-20913] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with WNT7A antibody diluted at 1:5000.
Immunohistochemistry-Paraffin: Wnt-7a Antibody [NBP2-20913] - Mouse pancreas. WNT7A antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Immunohistochemistry-Paraffin: Wnt-7a Antibody [NBP2-20913] - Mouse stomach. WNT7A antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ROR alpha/NR1F1
Antibody (784652) [Un ...
MAB8924
Human peripheral blood mononuclear cells (PBMCs) stimulated to induce Th17 cells were stained with Mouse Anti-Human CD4 PE‑conjugated Monoclonal Antibody (Catalog # FAB3791P) and either (A) Mouse Anti-Human ROR alpha /NR1F1 Monoclonal Antibody (Catalog # MAB8924) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed and permeabilized with FlowX FoxP3 Fixation & Permeabilization Buffer Kit (Catalog # FC012).
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ICFlow
Wnt-2b Antibody
AF3900
Wnt-2b Antibody
Species: Hu, Mu
Applications: ICC, WB
Wnt-5a
[Unconjugated]
645-WN/CF
Recombinant mouse Wnt-5a (645-WN/CF) inhibits Wnt-3a-induced alkaline phosphatase production in the MC3T3-E1 mouse preosteoblast cell line. The ED50 for this effect is 0.1-0.5 µg/mL in the presence of 5 ng/mL recombinant mouse Wnt-3a (1324-WN).
(163 Publications)
Species: Hu, Mu
Applications: BA
Wnt-3a
[Unconjugated]
5036-WN
Recombinant Human Wnt-3a (Catalog # 5036-WN) induces alkaline phosphatase production by the MC3T3-E1 mouse preosteoblast cell line. The ED50 is 1.7-fold better with more than twice the maximum response compared to the top competitor's Wnt-3a.
The lot-to-lot consistency of Recombinant Human Wnt-3a Protein (5036-WN) was assessed by testing the ability of three independent lots of the protein to induce alkaline phosphatase production in the MC3T3-E1 mouse preosteoblast cell line. Each trace on the graph represents data obtained from Recombinant Human Wnt-3a from a different manufacturing run. The ED50 for this effect is 5.00-25.0 ng/mL.
(319 Publications)
Species: Hu
Applications: BA, BA
Wnt-7b Antibody
AF3460
Western blot shows lysates of JAR human choriocarcinoma cell line and HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Wnt‑7b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3460) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Wnt‑7b at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(10 Publications)
Species: Hu
Applications: IHC, WB
Proteasome 19S S3
Antibody (OTI2A2) - A ...
NBP2-73636
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Proteasome 19S S3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S S3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Prot
Flow Cytometry: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - Analysis of Hela cells, using anti-Proteasome 19S S3 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(19 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Frizzled-10
Recombinant Protein A
NBP1-85754PEP
Frizzled-10 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Frizzled-10 Protein (NBP1-85754PEP) (0)

There are no publications for Frizzled-10 Protein (NBP1-85754PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frizzled-10 Protein (NBP1-85754PEP) (0)

There are no reviews for Frizzled-10 Protein (NBP1-85754PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Frizzled-10 Protein (NBP1-85754PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Frizzled-10 Products

Bioinformatics Tool for Frizzled-10 Protein (NBP1-85754PEP)

Discover related pathways, diseases and genes to Frizzled-10 Protein (NBP1-85754PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-10 Protein (NBP1-85754PEP)

Discover more about diseases related to Frizzled-10 Protein (NBP1-85754PEP).
 

Pathways for Frizzled-10 Protein (NBP1-85754PEP)

View related products by pathway.

PTMs for Frizzled-10 Protein (NBP1-85754PEP)

Learn more about PTMs related to Frizzled-10 Protein (NBP1-85754PEP).
 

Research Areas for Frizzled-10 Protein (NBP1-85754PEP)

Find related products by research area.

Blogs on Frizzled-10

There are no specific blogs for Frizzled-10, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Frizzled-10 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FZD10