FPRL1/FPR2 Antibody - BSA Free

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human lung shows strong cytoplasmic positivity in granulocytes.

Staining of human spleen shows moderate membranous positivity in cells in white pulp.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FPRL1/FPR2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FPRL1/FPR2 Antibody - BSA Free (NBP1-90180) is a polyclonal antibody validated for use in IHC and WB. Anti-FPRL1/FPR2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DTYCTFNFASWGGTPEERLKVAITMLTARG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FPR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reported in scientific literature (PMID:PMID: 33945545).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FPRL1/FPR2 Protein (NBP1-90180PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID: 33945545).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FPRL1/FPR2 Antibody - BSA Free

• ALXR
• FMLP-R-I
• FMLP-R-II
• FMLPX
• formyl peptide receptor 2
• Formyl peptide receptor-like 1RFP
• FPR2
• FPR2A
• FPRH1FMLP-related receptor I
• FPRL1
• FPRL1LXA4 receptor
• HM63
• HM63FPRH2
• lipoxin A4 receptor (formyl peptide receptor related)
• Lipoxin A4 receptor
• LXA4 Receptor
• LXA4RFMLP-R-I
• N-formyl peptide receptor 2
• RFP

Background

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors.Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein thatactivates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in ananti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FPRL1/FPR2 Antibody (NBP1-90180)(1)

Publication using NBP1-90180

• Kuzumoto T, Tanigawa T, Higashimori A et al. Protective role of resolvin D1, a pro-resolving lipid mediator, in nonsteroidal anti-inflammatory drug-induced small intestinal damage PloS one 2021-05-04 [PMID: 33945545] (IF/IHC, WB, Mouse)

FAQs for FPRL1/FPR2 Antibody (NBP1-90180). (Showing 1 - 1 of 1 FAQ).

1. I am looking for an FPRL1 antibody that is reactive to mouse only. Does Novus have the antibody in question?
   • To answer your question, unfortunately all our FPRL1 antibodies are polyclonal and would detect both mouse and human formyl peptide receptor-like-1 and we do not have any mouse monoclonal antibody for it.

Bioinformatics

• Gene Symbol: FPR2