FPGS Antibody

Images

 
Immunohistochemistry: FPGS Antibody [NBP2-48965] - Staining of human rectum shows distinct cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FPGS Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RVLLFNATGDRDPAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSAPSPEPGGSASLLL
Specificity
Specificity of human FPGS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FPGS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FPGS Recombinant Protein Antigen (NBP2-48965PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FPGS Antibody

  • EC 6.3.2.17
  • Folylpoly-gamma-glutamate synthetase
  • folylpolyglutamate synthase
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83430
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6457
Species: Hu
Applications: WB
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-06603
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FPGS Antibody (NBP2-48965) (0)

There are no publications for FPGS Antibody (NBP2-48965).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FPGS Antibody (NBP2-48965) (0)

There are no reviews for FPGS Antibody (NBP2-48965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FPGS Antibody (NBP2-48965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FPGS Antibody (NBP2-48965)

Discover related pathways, diseases and genes to FPGS Antibody (NBP2-48965). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FPGS Antibody (NBP2-48965)

Discover more about diseases related to FPGS Antibody (NBP2-48965).
 

Pathways for FPGS Antibody (NBP2-48965)

View related products by pathway.

PTMs for FPGS Antibody (NBP2-48965)

Learn more about PTMs related to FPGS Antibody (NBP2-48965).

Blogs on FPGS

There are no specific blogs for FPGS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FPGS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FPGS