FoxO1/FKHR Recombinant Protein Antigen

Images

 
There are currently no images for FoxO1/FKHR Protein (NBP1-84674PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FoxO1/FKHR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FOXO1.

Source: E.coli

Amino Acid Sequence: LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDM

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FOXO1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84674.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FoxO1/FKHR Recombinant Protein Antigen

  • FKH1
  • FKHR
  • FKHRforkhead box protein O1
  • forkhead box O1
  • Forkhead box protein O1A
  • forkhead homolog in rhabdomyosarcoma
  • Forkhead in rhabdomyosarcoma
  • FoxO1
  • FOXO1Aforkhead, Drosophila, homolog of, in rhabdomyosarcoma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP2-67892
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
NBP1-80533
Species: Hu, Mu
Applications: WB
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
MAB1675
Species: Hu, Mu, Rt, Ch
Applications: ICC
AF1555
Species: Hu
Applications: WB
MAB847
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow, KO
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-12793
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for FoxO1/FKHR Protein (NBP1-84674PEP) (0)

There are no publications for FoxO1/FKHR Protein (NBP1-84674PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxO1/FKHR Protein (NBP1-84674PEP) (0)

There are no reviews for FoxO1/FKHR Protein (NBP1-84674PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FoxO1/FKHR Protein (NBP1-84674PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional FoxO1/FKHR Products

Bioinformatics Tool for FoxO1/FKHR Protein (NBP1-84674PEP)

Discover related pathways, diseases and genes to FoxO1/FKHR Protein (NBP1-84674PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxO1/FKHR Protein (NBP1-84674PEP)

Discover more about diseases related to FoxO1/FKHR Protein (NBP1-84674PEP).
 

Pathways for FoxO1/FKHR Protein (NBP1-84674PEP)

View related products by pathway.

PTMs for FoxO1/FKHR Protein (NBP1-84674PEP)

Learn more about PTMs related to FoxO1/FKHR Protein (NBP1-84674PEP).
 

Research Areas for FoxO1/FKHR Protein (NBP1-84674PEP)

Find related products by research area.

Blogs on FoxO1/FKHR.

FOXO1/FKHR (fork head in Rhabdomyosarcoma)
FOXO1 belongs to the very large Forkhead family of transcription factors which contain a conserved distinct DNA-binding domain known as the Forkhead Box, or FOX. The Forkhead domain is a 100 amino acid long motif capable of binding and bending DNA,...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FoxO1/FKHR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXO1