Recombinant Human FoxJ1/HFH4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FoxJ1/HFH4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-421 of Human FOXJ1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FOXJ1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FoxJ1/HFH4 Protein

  • FKHL13
  • FKHL13forkhead transcription factor HFH-4
  • forkhead box J1
  • forkhead-like 13
  • Forkhead-related protein FKHL13
  • FoxJ1
  • Hepatocyte nuclear factor 3 forkhead homolog 4
  • HFH-4
  • HFH4fork head homologue 4
  • HFH-4forkhead box protein J1
  • MGC35202

Background

FOXJ1 is a member of the forkhead gene family, which was originally identified in Drosophila. The forkhead family is composed of transcription factors with a conserved 100-amino acid DNA-binding motif.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4218
Species: Hu
Applications: WB, IHC
NBP2-03868
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
AF4186
Species: Hu
Applications: WB, ICC
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00094234-M07
Species: Hu
Applications: ELISA, ICC/IF
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57977
Species: Hu
Applications: WB, IHC
NBP2-55686
Species: Hu
Applications: ICC/IF
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FoxJ1/HFH4 Recombinant Protein (H00002302-P01) (0)

There are no publications for FoxJ1/HFH4 Recombinant Protein (H00002302-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxJ1/HFH4 Recombinant Protein (H00002302-P01) (0)

There are no reviews for FoxJ1/HFH4 Recombinant Protein (H00002302-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxJ1/HFH4 Recombinant Protein (H00002302-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FoxJ1/HFH4 Products

Bioinformatics Tool for FoxJ1/HFH4 Recombinant Protein (H00002302-P01)

Discover related pathways, diseases and genes to FoxJ1/HFH4 Recombinant Protein (H00002302-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxJ1/HFH4 Recombinant Protein (H00002302-P01)

Discover more about diseases related to FoxJ1/HFH4 Recombinant Protein (H00002302-P01).
 

Pathways for FoxJ1/HFH4 Recombinant Protein (H00002302-P01)

View related products by pathway.

PTMs for FoxJ1/HFH4 Recombinant Protein (H00002302-P01)

Learn more about PTMs related to FoxJ1/HFH4 Recombinant Protein (H00002302-P01).
 

Research Areas for FoxJ1/HFH4 Recombinant Protein (H00002302-P01)

Find related products by research area.

Blogs on FoxJ1/HFH4

There are no specific blogs for FoxJ1/HFH4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FoxJ1/HFH4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXJ1
Entrez