FoxF2 Antibody (3F5)

Images

 
Western Blot: FoxF2 Antibody (3F5) [H00002295-M03] - Analysis of FOXF2 expression in human intestinal wall.
Immunocytochemistry/ Immunofluorescence: FoxF2 Antibody (3F5) [H00002295-M03] - Analysis of monoclonal antibody to FOXF2 on HeLa cell. Antibody concentration 30 ug/ml
Western Blot: FoxF2 Antibody (3F5) [H00002295-M03] - Western Blot analysis of FOXF2 expression in HeLa ( Cat # L013V1 ).
Western Blot: FoxF2 Antibody (3F5) [H00002295-M03] - Western Blot analysis of FOXF2 expression in NIH/3T3 ( Cat # L018V1 ).
Sandwich ELISA: FoxF2 Antibody (3F5) [H00002295-M03] - Detection limit for recombinant GST tagged FOXF2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FoxF2 Antibody (3F5) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
FOXF2 (NP_001443, 346 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV
Specificity
FOXF2 - forkhead box F2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against tissue lysate, cell lysate and recombinant protein for WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxF2 Antibody (3F5)

  • FKHL6
  • FKHL6forkhead box protein F2
  • forkhead box F2
  • forkhead-like 6
  • Forkhead-related activator 2
  • Forkhead-related protein FKHL6
  • Forkhead-related transcription factor 2
  • FoxF2
  • FREAC2
  • FREAC2FREAC-2

Background

FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4798
Species: Hu
Applications: WB
H00010210-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-1268
Species: Hu, Mu, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, PEP-ELISA, WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45736
Species: Hu
Applications: IHC, IHC-P, WB
H00002303-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
464-SH/CF
Species: Mu
Applications: BA
MAB4218
Species: Hu
Applications: IHC, WB
314-BP
Species: Hu
Applications: BA, BA
354-BP/CF
Species: Hu
Applications: BA
NBP1-77461
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32622
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-92789
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FoxF2 Antibody (H00002295-M03) (0)

There are no publications for FoxF2 Antibody (H00002295-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxF2 Antibody (H00002295-M03) (0)

There are no reviews for FoxF2 Antibody (H00002295-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FoxF2 Antibody (H00002295-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxF2 Antibody (3F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXF2
Entrez
OMIM
Uniprot