FoxF2 Antibody (2D7)

Images

 
Western Blot: FoxF2 Antibody (2D7) [H00002295-M01] - FOXF2 monoclonal antibody (M01), clone 2D7. Analysis of FOXF2 expression in H9c2(2-1).
Sandwich ELISA: FoxF2 Antibody (2D7) [H00002295-M01] - Detection limit for recombinant GST tagged FOXF2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
2D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FoxF2 Antibody (2D7) Summary

Immunogen
FOXF2 (NP_001443 346 a.a. - 443 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV
Specificity
FOXF2 - forkhead box F2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxF2 Antibody (2D7)

  • FKHL6
  • FKHL6forkhead box protein F2
  • forkhead box F2
  • forkhead-like 6
  • Forkhead-related activator 2
  • Forkhead-related protein FKHL6
  • Forkhead-related transcription factor 2
  • FoxF2
  • FREAC2
  • FREAC2FREAC-2

Background

FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4798
Species: Hu, Mu
Applications: WB
H00010210-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00094234-M07
Species: Hu
Applications: ELISA, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
MAB4218
Species: Hu
Applications: WB, IHC
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FoxF2 Antibody (H00002295-M01) (0)

There are no publications for FoxF2 Antibody (H00002295-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxF2 Antibody (H00002295-M01) (0)

There are no reviews for FoxF2 Antibody (H00002295-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxF2 Antibody (H00002295-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxF2 Products

FoxF2 H00002295-M01

Bioinformatics Tool for FoxF2 Antibody (H00002295-M01)

Discover related pathways, diseases and genes to FoxF2 Antibody (H00002295-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxF2 Antibody (H00002295-M01)

Discover more about diseases related to FoxF2 Antibody (H00002295-M01).
 

Pathways for FoxF2 Antibody (H00002295-M01)

View related products by pathway.

PTMs for FoxF2 Antibody (H00002295-M01)

Learn more about PTMs related to FoxF2 Antibody (H00002295-M01).

Blogs on FoxF2

There are no specific blogs for FoxF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxF2 Antibody (2D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXF2
Entrez
OMIM
Uniprot