FoxF1 Antibody

Images

 
Western Blot: FoxF1 Antibody [NBP2-87469] - WB Suggested Anti-Foxf1a Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Mouse Heart
Immunohistochemistry: FoxF1 Antibody [NBP2-87469] - Sample Type: Mouse E 18.5 Gut. Dilution: 1:1000

Product Details

Summary
Reactivity Mu, Hu, Rt, Ca, Eq, GpSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FoxF1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse FoxF1. Peptide sequence: GCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASA The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (93%), Rat (100%), Canine (93%), Equine (93%), Guinea Pig (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
FOXF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxF1 Antibody

  • FKHL5
  • FKHL5MGC105125
  • forkhead box F1
  • forkhead box protein F1
  • Forkhead, drosophila, homolog-like 5
  • Forkhead-related activator 1
  • Forkhead-related protein FKHL5
  • Forkhead-related transcription factor 1
  • FoxF1
  • FREAC-1
  • FREAC1ACDMPV

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84671
Species: Hu
Applications: WB, IHC, IHC-P
H00002295-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF2400
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NB600-600
Species: Hu, Mu, Ca
Applications: WB, ChIP, ELISA, Flow, IB, IHC, IHC-P, Flow-IC, KD
H00002303-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00002300-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00010210-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1268
Species: Hu, Mu, Ze
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, KD, KO
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB300-925
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-77431
Species: Hu
Applications: WB, IHC

Publications for FoxF1 Antibody (NBP2-87469) (0)

There are no publications for FoxF1 Antibody (NBP2-87469).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxF1 Antibody (NBP2-87469) (0)

There are no reviews for FoxF1 Antibody (NBP2-87469). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxF1 Antibody (NBP2-87469) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FoxF1 Products

Bioinformatics Tool for FoxF1 Antibody (NBP2-87469)

Discover related pathways, diseases and genes to FoxF1 Antibody (NBP2-87469). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxF1 Antibody (NBP2-87469)

Discover more about diseases related to FoxF1 Antibody (NBP2-87469).
 

Pathways for FoxF1 Antibody (NBP2-87469)

View related products by pathway.

PTMs for FoxF1 Antibody (NBP2-87469)

Learn more about PTMs related to FoxF1 Antibody (NBP2-87469).

Blogs on FoxF1

There are no specific blogs for FoxF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXF1