Recombinant Human FoxC2 Protein

Images

 
SDS-Page: Recombinant Human FoxC2 Protein [H00002303-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FoxC2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 421-501 of Human FoxC2

Source: Wheat Germ

Amino Acid Sequence: AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
FOXC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FoxC2 Protein

  • Fkh14
  • FKHL14LD
  • forkhead box C2 (MFH-1, mesenchyme forkhead 1)
  • forkhead, Drosophila, homolog-like 14
  • Forkhead-related protein FKHL14
  • FoxC2
  • LD
  • Mesenchyme fork head protein 1
  • mesenchyme forkhead 1
  • MFH-1 protein
  • MFH1
  • MFH-1
  • MFH1forkhead box protein C2
  • Transcription factor FKH-14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57770
Species: Hu
Applications: WB
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-40877
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00002303-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for FoxC2 Recombinant Protein (H00002303-Q01) (0)

There are no publications for FoxC2 Recombinant Protein (H00002303-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxC2 Recombinant Protein (H00002303-Q01) (0)

There are no reviews for FoxC2 Recombinant Protein (H00002303-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxC2 Recombinant Protein (H00002303-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FoxC2 Recombinant Protein (H00002303-Q01)

Discover related pathways, diseases and genes to FoxC2 Recombinant Protein (H00002303-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxC2 Recombinant Protein (H00002303-Q01)

Discover more about diseases related to FoxC2 Recombinant Protein (H00002303-Q01).
 

Pathways for FoxC2 Recombinant Protein (H00002303-Q01)

View related products by pathway.

PTMs for FoxC2 Recombinant Protein (H00002303-Q01)

Learn more about PTMs related to FoxC2 Recombinant Protein (H00002303-Q01).

Blogs on FoxC2.

The affects of Perilipin 2 on diet and metabolism
Perilipin 2 belongs to the Perilipin family, which consists of proteins that coat intracellular lipid storage droplets. Perilipin 2 in particular is involved in lipid globule surface membrane composition, and has also been implicated in the develo...  Read full blog post.

Customers Who Bought This Also Bought

FoxC2 Antibody
NB100-1269

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FoxC2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXC2
Entrez