FOXA3 Antibody - BSA Free

Western Blot: FOXA3 Antibody [NBP2-87462] - Host: Rabbit. Target Name: FOXA3. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/ml

Western Blot: FOXA3 Antibody [NBP2-87462] - WB Suggested Anti-Foxa3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Mouse Brain

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FOXA3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FOXA3 Antibody - BSA Free (NBP2-87462) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse FOXA3. Peptide sequence: YNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FOXA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FOXA3 Antibody - BSA Free

• FKHH3
• Fork head-related protein FKH H3
• forkhead box A3
• Forkhead box protein A3
• hepatocyte nuclear factor 3, gamma
• hepatocyte nuclear factor 3-gamma
• HNF-3G
• HNF-3-gamma
• HNF3GTCF-3G
• MGC10179
• TCF3G
• Transcription factor 3G

Background

FOXA3 encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FOXA3