We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FOX2 Recombinant Protein Antigen

Images

 
There are currently no images for FOX2 Protein (NBP1-91910PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FOX2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBFOX2.

Source: E. coli

Amino Acid Sequence: PTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBFOX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91910.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FOX2 Recombinant Protein Antigen

  • dJ106I20.3
  • Fox-1 homolog B
  • fox-1 homologue
  • FOX2Fox-2
  • fxh
  • hexaribonucleotide binding protein 2
  • Hexaribonucleotide-binding protein 2
  • HRNBP2FOX-2
  • RBM9RTAHNRBP2
  • Repressor of tamoxifen transcriptional activity
  • RNA binding motif protein 9
  • RNA binding protein fox-1 homolog 2
  • RNA binding protein, fox-1 homolog (C. elegans) 2
  • RNA-binding motif protein 9
  • RNA-binding protein 9

Background

FOX2 is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13169
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-95260
Species: V-Vi
Applications: ELISA, IHC, WB
NBP3-13937
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NBP2-16094
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, KO, WB
NBP1-84730
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DNST0
Species: Hu
Applications: ELISA
NBP1-77263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-07622
Species: Hu
Applications: ELISA, ICC/IF, WB
202-IL
Species: Hu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP1-77077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-91910PEP
Species: Hu
Applications: AC

Publications for FOX2 Protein (NBP1-91910PEP) (0)

There are no publications for FOX2 Protein (NBP1-91910PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOX2 Protein (NBP1-91910PEP) (0)

There are no reviews for FOX2 Protein (NBP1-91910PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FOX2 Protein (NBP1-91910PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FOX2 Products

Research Areas for FOX2 Protein (NBP1-91910PEP)

Find related products by research area.

Blogs on FOX2

There are no specific blogs for FOX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FOX2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBFOX2