FOLR2 Antibody (4B12)

Images

 
ELISA: FOLR2 Antibody (4B12) [H00002350-M04] - Detection limit for recombinant GST tagged FOLR2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4B12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FOLR2 Antibody (4B12) Summary

Immunogen
FOLR2 (NP_000794.1, 36 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQTWRKERFLDVPL
Specificity
FOLR2 - folate receptor 2 (fetal) (4B12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOLR2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOLR2 Antibody (4B12)

  • beta-HFR
  • FBP
  • FBP/PL-1
  • folate receptor 2 (fetal)
  • Folate receptor 2
  • folate receptor beta
  • folate receptor, beta
  • Folate receptor, fetal/placental
  • folate-binding protein, fetal/placental
  • FOLR2
  • FR-beta
  • FR-P3
  • Placental folate-binding protein

Background

The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5646
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, KO, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NBP1-83435
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89781
Species: Hu
Applications: IHC, IHC-P, WB
MAB3428
Species: Hu
Applications: IHC, WB
NBP1-62583
Species: Hu
Applications: WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83918
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00051776-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-15687
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
AF6517
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB

Publications for FOLR2 Antibody (H00002350-M04) (0)

There are no publications for FOLR2 Antibody (H00002350-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOLR2 Antibody (H00002350-M04) (0)

There are no reviews for FOLR2 Antibody (H00002350-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOLR2 Antibody (H00002350-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOLR2 Products

Bioinformatics Tool for FOLR2 Antibody (H00002350-M04)

Discover related pathways, diseases and genes to FOLR2 Antibody (H00002350-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOLR2 Antibody (H00002350-M04)

Discover more about diseases related to FOLR2 Antibody (H00002350-M04).
 

Pathways for FOLR2 Antibody (H00002350-M04)

View related products by pathway.

PTMs for FOLR2 Antibody (H00002350-M04)

Learn more about PTMs related to FOLR2 Antibody (H00002350-M04).
 

Research Areas for FOLR2 Antibody (H00002350-M04)

Find related products by research area.

Blogs on FOLR2

There are no specific blogs for FOLR2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOLR2 Antibody (4B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOLR2
Entrez
Uniprot