Folliculin Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit Folliculin Antibody - Azide and BSA Free (NBP3-03257) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 341-579 of human Folliculin (NP_659434.2). RKLPVFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTASESRN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FLCN |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for Folliculin Antibody - Azide and BSA Free
Background
Belonging to the folliculin family, this gene is involved in the regulation of protein phosphorylation and protein binding. Located on chromosome 17 within the Smith-Magenis region, folliculin is a possible tumor suppressor gene associated with hereditary renal carcinoma. Mutations in this gene are associated with Birt-Hogg Dube syndrome. Folliculin may play a role in the pathogenesis of kidney cancer. Additionally, this gene may be involved in colorectal tomorigenesis and is also known to be involved in energy and nutrient sensing through the AMPK and mTOR signaling pathways. Common diseases associated with this gene include renal-cell carcinoma, colorectal cancer, renal cancer, Birt-Hogg-Dube syndrome and primary spontaneous pneumothorax.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Folliculin Antibody (NBP3-03257) (0)
There are no publications for Folliculin Antibody (NBP3-03257).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Folliculin Antibody (NBP3-03257) (0)
There are no reviews for Folliculin Antibody (NBP3-03257).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Folliculin Antibody (NBP3-03257) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Folliculin Products
Research Areas for Folliculin Antibody (NBP3-03257)
Find related products by research area.
|
Blogs on Folliculin