FN3K Antibody

Images

 
Immunohistochemistry-Paraffin: FN3K Antibody [NBP2-32349] - Staining of human fallopian tube shows distinct positivity in red blood cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FN3K Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EVASLEALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FN3K
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FN3K Protein (NBP2-32349PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FN3K Antibody

  • EC 2.7.1.-
  • FN3K
  • fructosamine 3 kinase
  • Fructosamine-3-kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-39063
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81330
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14891
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-48336
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF6144
Species: Hu
Applications: WB, Simple Western
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
640-A3
Species: Mu
NBP2-32349
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for FN3K Antibody (NBP2-32349) (0)

There are no publications for FN3K Antibody (NBP2-32349).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FN3K Antibody (NBP2-32349) (0)

There are no reviews for FN3K Antibody (NBP2-32349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FN3K Antibody (NBP2-32349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FN3K Products

Bioinformatics Tool for FN3K Antibody (NBP2-32349)

Discover related pathways, diseases and genes to FN3K Antibody (NBP2-32349). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FN3K Antibody (NBP2-32349)

Discover more about diseases related to FN3K Antibody (NBP2-32349).
 

Pathways for FN3K Antibody (NBP2-32349)

View related products by pathway.

PTMs for FN3K Antibody (NBP2-32349)

Learn more about PTMs related to FN3K Antibody (NBP2-32349).

Blogs on FN3K

There are no specific blogs for FN3K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FN3K Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FN3K
Entrez