Fructosamine-3-kinase-related Antibody

Images

 
Western Blot: Fructosamine-3-kinase-related Antibody [NBP2-39063] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry: Fructosamine-3-kinase-related Antibody [NBP2-39063] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fructosamine-3-kinase-related Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD
Specificity
Specificity of human Fructosamine-3-kinase-related antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FN3KRP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fructosamine-3-kinase-related Protein (NBP2-39063PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fructosamine-3-kinase-related Antibody

  • EC 2.7.1.-
  • FLJ12171
  • FN3KL
  • FN3K-related protein
  • FN3K-RP
  • fructosamine 3 kinase related protein
  • Fructosamine-3-kinase-related protein
  • ketosamine-3-kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32349
Species: Hu
Applications: IHC, IHC-P
H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
H00008720-Q01
Species: Hu
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-39063
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Fructosamine-3-kinase-related Antibody (NBP2-39063) (0)

There are no publications for Fructosamine-3-kinase-related Antibody (NBP2-39063).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fructosamine-3-kinase-related Antibody (NBP2-39063) (0)

There are no reviews for Fructosamine-3-kinase-related Antibody (NBP2-39063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fructosamine-3-kinase-related Antibody (NBP2-39063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Fructosamine-3-kinase-related Antibody (NBP2-39063)

Discover related pathways, diseases and genes to Fructosamine-3-kinase-related Antibody (NBP2-39063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fructosamine-3-kinase-related Antibody (NBP2-39063)

Discover more about diseases related to Fructosamine-3-kinase-related Antibody (NBP2-39063).
 

Pathways for Fructosamine-3-kinase-related Antibody (NBP2-39063)

View related products by pathway.

PTMs for Fructosamine-3-kinase-related Antibody (NBP2-39063)

Learn more about PTMs related to Fructosamine-3-kinase-related Antibody (NBP2-39063).
 

Research Areas for Fructosamine-3-kinase-related Antibody (NBP2-39063)

Find related products by research area.

Blogs on Fructosamine-3-kinase-related

There are no specific blogs for Fructosamine-3-kinase-related, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fructosamine-3-kinase-related Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FN3KRP
Uniprot