Recombinant Human FMRP Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FMRP Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 121-220 of Human FMRP

Source: Wheat Germ

Amino Acid Sequence: ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FMR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FMRP Protein

  • FMRPFRAXAPOF
  • fragile X mental retardation 1 protein
  • fragile X mental retardation 1
  • MGC87458
  • POF1
  • premature ovarian failure 1
  • Protein FMR-1

Background

FMR1 - fragile X mental retardation 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55795
Species: Hu
Applications: ICC/IF
NBP1-81872
Species: Hu
Applications: IHC, IHC-P
NBP1-89546
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-259
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-04611
Species: Hu
NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
PP-A9033A-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88191
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FMRP Partial Recombinant Protein (H00002332-Q01) (0)

There are no publications for FMRP Partial Recombinant Protein (H00002332-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FMRP Partial Recombinant Protein (H00002332-Q01) (0)

There are no reviews for FMRP Partial Recombinant Protein (H00002332-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FMRP Partial Recombinant Protein (H00002332-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FMRP Products

Bioinformatics Tool for FMRP Partial Recombinant Protein (H00002332-Q01)

Discover related pathways, diseases and genes to FMRP Partial Recombinant Protein (H00002332-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FMRP Partial Recombinant Protein (H00002332-Q01)

Discover more about diseases related to FMRP Partial Recombinant Protein (H00002332-Q01).
 

Pathways for FMRP Partial Recombinant Protein (H00002332-Q01)

View related products by pathway.

PTMs for FMRP Partial Recombinant Protein (H00002332-Q01)

Learn more about PTMs related to FMRP Partial Recombinant Protein (H00002332-Q01).
 

Research Areas for FMRP Partial Recombinant Protein (H00002332-Q01)

Find related products by research area.

Blogs on FMRP

There are no specific blogs for FMRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FOXL2 Antibody
NB100-1277

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FMRP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FMR1