FMO2 Antibody

Western Blot: FMO2 Antibody [NBP1-85952] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: FMO2 Antibody [NBP1-85952] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: FMO2 Antibody [NBP1-85952] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: FMO2 Antibody [NBP1-85952] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.

Immunohistochemistry-Paraffin: FMO2 Antibody [NBP1-85952] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Discontinued

FMO2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IFPTAELQARWVTRVFKGLCSLPSERTMMMDIIKRNEKRIDLFGESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKLAVRLYFGPCN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FMO2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FMO2 Antibody

• dimethylaniline monooxygenase [N-oxide-forming] 2
• Dimethylaniline oxidase 2
• EC 1.14.13.8
• flavin containing monooxygenase 2 (non-functional)
• flavin containing monooxygenase 2
• FLJ40826
• FMO 1B1
• FMO 2
• FMO, pulmonary
• FMO1B1
• Pulmonary flavin-containing monooxygenase 2

Background

The flavin-containing monooxygenases are NADPH-dependent enzymes that catalyze the oxidation of many drugs and xenobiotics. In most mammals, there is a flavin-containing monooxygenase that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, in humans, this enzyme is truncated and is probably rapidly degraded. The protein encoded by this gene represents the truncated form and apparently has no catalytic activity. A functional allele found in African Americans has been reported, but no sequence evidence has been deposited to support the finding. This gene is found in a cluster with the FMO1, FMO3, and FMO4 genes on chromosome 1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FMO2 Antibody (NBP1-85952)(1)

Publication using NBP1-85952

• Wang L, Zha H, Huang J, Shi L Flavin containing monooxygenase 2 regulates renal tubular cell fibrosis and paracrine secretion via SMURF2 in AKI?CKD transformation International journal of molecular medicine 2023-11-01 [PMID: 37800598] (IHC-P, WB, Mouse)

Bioinformatics

• Gene Symbol: FMO2