FMNL3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FMNL3 Antibody [NBP1-84092] - Staining of human cell line A-431 shows localization to plasma membrane, cytosol, the Golgi apparatus & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FMNL3 Antibody [NBP1-84092] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells of tubules.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FMNL3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FMNL3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FMNL3 Protein (NBP1-84092PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FMNL3 Antibody - BSA Free

• formin-like 3

Background

FMNL3, also known as Formin-like protein 3, has 3 isoforms, a 1,028 amino acid isoform that is 117 kDs, a 976 amino acid isoform that is 111 kDa and a 1,027 amino acid isoform that is 117 kDa, plays an important role in the regulation of cell morphology and cytoskeletal organization and is required in the control of cell shape and migration. Disease research is currently being studied with relation to FMNL3 and chondrosarcoma and glioblastoma. This protein has been linked to the cytoskeleton organization, actin cytoskeleton organization, regulation of cell shape, cellular component organization, and cell migration pathways in interaction with PRPF40A and YWHAB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FMNL3 Antibody (NBP1-84092)(2)

Publications using NBP1-84092

• Teo JL, Gomez GA, Weeratunga S et al. Caveolae Control Contractile Tension for Epithelia to Eliminate Tumor Cells Dev. Cell 2020-05-21 [PMID: 32485139]
• Jiang D, Burger CA, Casasent AK et al. Spatiotemporal gene expression patterns reveal molecular relatedness between retinal laminae J. Comp. Neurol. 2019-10-14 [PMID: 31609468]

Bioinformatics

• Gene Symbol: FMNL3