Flt-3/Flk-2/CD135 Recombinant Protein Antigen

Images

 
There are currently no images for Flt-3/Flk-2/CD135 Recombinant Protein Antigen (NBP2-57187PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Flt-3/Flk-2/CD135 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Flt-3/Flk-2/CD135.

Source: E. coli

Amino Acid Sequence: PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FLT3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57187.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Flt-3/Flk-2/CD135 Recombinant Protein Antigen

  • CD135 antigen
  • CD135
  • EC 2.7.10
  • fetal liver kinase 2
  • FL cytokine receptor
  • FLK2
  • Flk-2
  • FLT3 receptor tyrosine kinase
  • Flt3
  • Flt-3
  • Fms-like tyrosine kinase 3
  • fms-related tyrosine kinase 3
  • growth factor receptor tyrosine kinase type III
  • Stem cell tyrosine kinase 1
  • STK-1
  • STK1EC 2.7.10.1
  • Tyrosine-protein kinase receptor FLT3

Background

Stem cell tyrosine kinase (STK-1) has been cloned from a CD34+ hematopoietic stem cell enriched library and identified as the human homolog of a previously identified gene of mouse origin designated either Flk-2 or Flt-3. The STK-1 cDNA encodes a protein of 993 amino acids with 85% identity to Flt-3/Flk-2. STK-1 is a member of the type III receptor tyrosine kinase family that includes Kit (steel factor receptor), Fms and PDGF. STK-1 expression in blood and marrow is restricted to CD34+ cells, a population greatly enriched for hematopoietic stem/progenitor cells. STK-1 antiserum recognizes two polypeptides in these cells. The mouse homolog of STK-1, designated Flt-3/ Flk-2, is expressed at high levels in hematopoietic cells and also in neural, gonadal, hepatic and placental tissues. It has been suggested that STK-1 and its murine homolog Flt-3/ Flk-2 may function as growth factor receptors on hematopoietic stem and/or progenitor cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
427-FL
Species: Mu
Applications: BA
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
255-SC
Species: Hu
Applications: BA
AF4117
Species: Rt
Applications: IHC, WB
203-IL
Species: Hu
Applications: BA
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
NBP2-67429
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
AF7094
Species: Hu
Applications: IHC
NBP1-26612
Species: Hu
Applications: IP (-), WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB3291
Species: Hu
Applications: IHC, Neut, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
207-IL
Species: Hu
Applications: BA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Publications for Flt-3/Flk-2/CD135 Recombinant Protein Antigen (NBP2-57187PEP) (0)

There are no publications for Flt-3/Flk-2/CD135 Recombinant Protein Antigen (NBP2-57187PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flt-3/Flk-2/CD135 Recombinant Protein Antigen (NBP2-57187PEP) (0)

There are no reviews for Flt-3/Flk-2/CD135 Recombinant Protein Antigen (NBP2-57187PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Flt-3/Flk-2/CD135 Recombinant Protein Antigen (NBP2-57187PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Flt-3/Flk-2/CD135 Products

Research Areas for Flt-3/Flk-2/CD135 Recombinant Protein Antigen (NBP2-57187PEP)

Find related products by research area.

Blogs on Flt-3/Flk-2/CD135

There are no specific blogs for Flt-3/Flk-2/CD135, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Flt-3/Flk-2/CD135 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FLT3