Flt-3/Flk-2/CD135 Antibody (3H1)

Images

 
Immunocytochemistry/ Immunofluorescence: Flt-3/Flk-2/CD135 Antibody (3H1) [H00002322-M06] - Analysis of monoclonal antibody to FLT3 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: Flt-3/Flk-2/CD135 Antibody (3H1) [H00002322-M06] - Detection limit for recombinant GST tagged FLT3 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
3H1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Flt-3/Flk-2/CD135 Antibody (3H1) Summary

Immunogen
FLT3 (NP_004110, 91 a.a. - 190 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FLT3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Flt-3/Flk-2/CD135 Antibody (3H1)

  • CD135 antigen
  • CD135
  • EC 2.7.10
  • fetal liver kinase 2
  • FL cytokine receptor
  • FLK2
  • Flk-2
  • FLT3 receptor tyrosine kinase
  • Flt3
  • Flt-3
  • Fms-like tyrosine kinase 3
  • fms-related tyrosine kinase 3
  • growth factor receptor tyrosine kinase type III
  • Stem cell tyrosine kinase 1
  • STK-1
  • STK1EC 2.7.10.1
  • Tyrosine-protein kinase receptor FLT3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
AF2988
Species: Mu, Rt
Applications: WB
NB600-248
Species: Hu
Applications: WB, IP
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-37292
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Flt-3/Flk-2/CD135 Antibody (H00002322-M06) (0)

There are no publications for Flt-3/Flk-2/CD135 Antibody (H00002322-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flt-3/Flk-2/CD135 Antibody (H00002322-M06) (0)

There are no reviews for Flt-3/Flk-2/CD135 Antibody (H00002322-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Flt-3/Flk-2/CD135 Antibody (H00002322-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Flt-3/Flk-2/CD135 Products

Bioinformatics Tool for Flt-3/Flk-2/CD135 Antibody (H00002322-M06)

Discover related pathways, diseases and genes to Flt-3/Flk-2/CD135 Antibody (H00002322-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flt-3/Flk-2/CD135 Antibody (H00002322-M06)

Discover more about diseases related to Flt-3/Flk-2/CD135 Antibody (H00002322-M06).
 

Pathways for Flt-3/Flk-2/CD135 Antibody (H00002322-M06)

View related products by pathway.

PTMs for Flt-3/Flk-2/CD135 Antibody (H00002322-M06)

Learn more about PTMs related to Flt-3/Flk-2/CD135 Antibody (H00002322-M06).
 

Research Areas for Flt-3/Flk-2/CD135 Antibody (H00002322-M06)

Find related products by research area.

Blogs on Flt-3/Flk-2/CD135

There are no specific blogs for Flt-3/Flk-2/CD135, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Flt-3/Flk-2/CD135 Antibody (3H1) and receive a gift card or discount.

Bioinformatics

Gene Symbol FLT3
Entrez
Uniprot