FLIP Recombinant Protein Antigen

Images

 
There are currently no images for FLIP Protein (NBP1-85675PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FLIP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CFLAR.

Source: E. coli

Amino Acid Sequence: IHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CFLAR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85675.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FLIP Recombinant Protein Antigen

  • CASHFADD-like antiapoptotic molecule 1
  • CASP8 and FADD-like apoptosis regulator
  • CASP8AP1
  • Caspase homolog
  • Caspase-eight-related protein
  • Caspase-like apoptosis regulatory protein
  • caspase-related inducer of apoptosis
  • CASPER
  • CasperFLAME1
  • Cellular FLICE-like inhibitory protein
  • CFLAR
  • c-FLIPR
  • c-FLIPS
  • CLARPMACH-related inducer of toxicity
  • FADD-like apoptotic molecule
  • FLAME
  • FLAME-1
  • FLIP
  • I-FLICE
  • I-FLICEMRITc-FLIPFLIPc-FLIPL
  • Inhibitor of FLICE
  • usurpin beta
  • Usurpin

Background

Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
375-TL
Species: Hu
Applications: BA
7398-FS
Species: Hu
Applications: BA
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-15951
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DFL00B
Species: Hu
Applications: ELISA
AF347
Species: Hu
Applications: IHC, Neut, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Publications for FLIP Protein (NBP1-85675PEP) (0)

There are no publications for FLIP Protein (NBP1-85675PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLIP Protein (NBP1-85675PEP) (0)

There are no reviews for FLIP Protein (NBP1-85675PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FLIP Protein (NBP1-85675PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FLIP Products

Research Areas for FLIP Protein (NBP1-85675PEP)

Find related products by research area.

Blogs on FLIP.

TRAIL-R2: The Trail Less Traveled
Cells undergo apoptotic programmed cell death in response to various stimuli, and this key mechanism is necessary for cellular morphogenesis, tissue homeostasis, and host defense. Particular cytokines such as tumor necrosis factor (TNF) and the Fas li...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FLIP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CFLAR