Flavin containing monooxygenase 4 Recombinant Protein Antigen

Images

 
There are currently no images for Flavin containing monooxygenase 4 Protein (NBP2-14020PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Flavin containing monooxygenase 4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FMO4.

Source: E. coli

Amino Acid Sequence: KGLCKIPPSQKLMMEATEKEQLIKRGVFKDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FMO4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14020. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Flavin containing monooxygenase 4 Recombinant Protein Antigen

  • dimethylaniline monooxygenase [N-oxide-forming] 4
  • Dimethylaniline oxidase 4
  • EC 1.14.13.8
  • flavin containing monooxygenase 4
  • FMO 4
  • FMO2
  • Hepatic flavin-containing monooxygenase 4

Background

FMO4, also known as Dimethylaniline monooxygenase [N-oxide-forming] 4 or Flavin containing monooxygenase 4, is a 558 amino acid protein that is 63 kDa, most commonly found in liver tissue with microsome membrane and endoplasmic reticulum membrane subcellular location, and is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Current research is being performed on several diseases and disorders including trimethylaminuria, hepatitis, prader-willi syndrome, plasma cell neoplasm, and hearing loss. This protein has been shown to have interactions with CYP3A5, CYP3A4, CYP3A7, CYP2D6 and CYP3A43 in xenobiotic metabolic and oxidation-reduction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86412
Species: Hu
Applications: IHC,  IHC-P
NBP1-33583
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86093
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-01437
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-85367
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NB600-836
Species: Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-81765
Species: Hu
Applications: IHC,  IHC-P
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001549-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-14020PEP
Species: Hu
Applications: AC

Publications for Flavin containing monooxygenase 4 Protein (NBP2-14020PEP) (0)

There are no publications for Flavin containing monooxygenase 4 Protein (NBP2-14020PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flavin containing monooxygenase 4 Protein (NBP2-14020PEP) (0)

There are no reviews for Flavin containing monooxygenase 4 Protein (NBP2-14020PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Flavin containing monooxygenase 4 Protein (NBP2-14020PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Flavin containing monooxygenase 4 Products

Blogs on Flavin containing monooxygenase 4

There are no specific blogs for Flavin containing monooxygenase 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Flavin containing monooxygenase 4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FMO4