FLAD1 Antibody

Images

 
Immunohistochemistry-Paraffin: FLAD1 Antibody [NBP1-84751] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FLAD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRGYTSLGSRENTVRNPALKCLSPGGHPTYRPAYLLENEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FLAD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FLAD1 Protein (NBP1-84751PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FLAD1 Antibody

  • EC 2.7.7
  • FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae)
  • FAD1
  • Fad1, flavin adenine dinucleotide synthetase, homolog (yeast)
  • FAD-synthetase
  • Flavin adenine dinucleotide synthase
  • flavin adenine dinucleotide synthetase
  • flavin adenine dinucleotide synthetase, homolog
  • MGC31803
  • MGC40255
  • PP591

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84312
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84311
Species: Hu
Applications: IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7550
Species: Hu
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91877
Species: Hu
Applications: IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1951
Species: Hu, Mu, Rt, Bv, Ch, Fe, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FLAD1 Antibody (NBP1-84751) (0)

There are no publications for FLAD1 Antibody (NBP1-84751).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLAD1 Antibody (NBP1-84751) (0)

There are no reviews for FLAD1 Antibody (NBP1-84751). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FLAD1 Antibody (NBP1-84751) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLAD1 Products

Bioinformatics Tool for FLAD1 Antibody (NBP1-84751)

Discover related pathways, diseases and genes to FLAD1 Antibody (NBP1-84751). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLAD1 Antibody (NBP1-84751)

Discover more about diseases related to FLAD1 Antibody (NBP1-84751).
 

Pathways for FLAD1 Antibody (NBP1-84751)

View related products by pathway.

PTMs for FLAD1 Antibody (NBP1-84751)

Learn more about PTMs related to FLAD1 Antibody (NBP1-84751).

Blogs on FLAD1

There are no specific blogs for FLAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLAD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FLAD1