FLAD1 Antibody - BSA Free

Immunohistochemistry-Paraffin: FLAD1 Antibody [NBP1-84751] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FLAD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FLAD1 Antibody - BSA Free (NBP1-84751) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRGYTSLGSRENTVRNPALKCLSPGGHPTYRPAYLLENEE
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FLAD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FLAD1 Protein (NBP1-84751PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FLAD1 Antibody - BSA Free

• EC 2.7.7
• FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae)
• FAD1
• Fad1, flavin adenine dinucleotide synthetase, homolog (yeast)
• FAD-synthetase
• Flavin adenine dinucleotide synthase
• flavin adenine dinucleotide synthetase
• flavin adenine dinucleotide synthetase, homolog
• MGC31803
• MGC40255
• PP591

Background

The FLAD1 gene encodes the enzyme that catalyzes adenylation of flavin mononucleotide (FMN) to form flavin adeninedinucleotide (FAD) coenzyme. Alternatively spliced transcript variants encoding distinct isoforms have been observed.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FLAD1