FKRP Antibody

Images

 
Western Blot: FKRP Antibody [NBP2-32543] - Analysis in human plasma.
Immunohistochemistry-Paraffin: FKRP Antibody [NBP2-32543] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: FKRP Antibody [NBP2-32543] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: FKRP Antibody [NBP2-32543] - Staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: FKRP Antibody [NBP2-32543] - Staining of human kidney shows moderate cytoplasmic positivity in a subset of tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKRP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ETARYVVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKRP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FKRP Protein (NBP2-32543PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKRP Antibody

  • EC 2.-
  • fukutin related protein
  • fukutin-related protein
  • LGMD2IFLJ12576
  • MDC1CMGC2991
  • MDDGA5
  • MDDGB5
  • MDDGC5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33383
Species: Hu
Applications: WB, ICC/IF
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-33084
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86152
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-49865
Species: Hu
Applications: WB, PEP-ELISA
NBP1-33737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr

Publications for FKRP Antibody (NBP2-32543) (0)

There are no publications for FKRP Antibody (NBP2-32543).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKRP Antibody (NBP2-32543) (0)

There are no reviews for FKRP Antibody (NBP2-32543). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKRP Antibody (NBP2-32543) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKRP Products

Bioinformatics Tool for FKRP Antibody (NBP2-32543)

Discover related pathways, diseases and genes to FKRP Antibody (NBP2-32543). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKRP Antibody (NBP2-32543)

Discover more about diseases related to FKRP Antibody (NBP2-32543).
 

Pathways for FKRP Antibody (NBP2-32543)

View related products by pathway.

PTMs for FKRP Antibody (NBP2-32543)

Learn more about PTMs related to FKRP Antibody (NBP2-32543).

Blogs on FKRP

There are no specific blogs for FKRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKRP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKRP