FKRP Antibody

Images

 
Western Blot: FKRP Antibody [NBP1-69029] - Mouse Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKRP Antibody Summary

Immunogen
Synthetic peptides corresponding to Fkrp (fukutin related protein) The peptide sequence was selected from the C terminal of Fkrp. Peptide sequence LDHRQDVEFPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKRP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Fkrp and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FKRP Antibody

  • EC 2.-
  • fukutin related protein
  • fukutin-related protein
  • LGMD2IFLJ12576
  • MDC1CMGC2991
  • MDDGA5
  • MDDGB5
  • MDDGC5

Background

Fkrp could be a transferase involved in the modification of glycan moieties of alpha-dystroglycan (DAG1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33383
Species: Hu
Applications: WB, ICC/IF
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-33084
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86152
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-49865
Species: Hu
Applications: WB, PEP-ELISA
NBP1-33737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr

Publications for FKRP Antibody (NBP1-69029) (0)

There are no publications for FKRP Antibody (NBP1-69029).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKRP Antibody (NBP1-69029) (0)

There are no reviews for FKRP Antibody (NBP1-69029). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKRP Antibody (NBP1-69029) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKRP Products

Bioinformatics Tool for FKRP Antibody (NBP1-69029)

Discover related pathways, diseases and genes to FKRP Antibody (NBP1-69029). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKRP Antibody (NBP1-69029)

Discover more about diseases related to FKRP Antibody (NBP1-69029).
 

Pathways for FKRP Antibody (NBP1-69029)

View related products by pathway.

PTMs for FKRP Antibody (NBP1-69029)

Learn more about PTMs related to FKRP Antibody (NBP1-69029).

Blogs on FKRP

There are no specific blogs for FKRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKRP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKRP
Uniprot