FKBP51/FKBP5 Antibody - BSA Free

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84677] - Staining in human breast and cerebral cortex tissues using anti-FKBP5 antibody. Corresponding FKBP5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84677] - Staining of human breast shows high expression.

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84677] - Staining of human cerebral cortex shows low expression as expected.

Analysis using Anti-FKBP5 antibody HPA031092 (A) shows similar pattern to independent antibody HPA031093 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FKBP51/FKBP5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FKBP51/FKBP5 Antibody - BSA Free (NBP1-84677) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FKBP5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FKBP51/FKBP5 Recombinant Protein Antigen (NBP1-84677PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FKBP51/FKBP5 Antibody - BSA Free

• 51 kDa FKBP
• 54 kDa progesterone receptor-associated immunophilin
• AIG6,51 kDa FK506-binding protein
• Androgen-regulated protein 6
• Dit1
• FF1 antigen
• FK506 binding protein 5
• FK506-binding protein 5
• FKBP5
• FKBP-5
• FKBP51
• FKBP-51
• FKBP51PPIase FKBP5
• FKBP54
• FKBP54EC 5.2.1.8
• HSP90-binding immunophilin
• MGC111006
• p54
• P54,51 kDa FK506-binding protein 5
• peptidyl-prolyl cis-trans isomerase FKBP5
• peptidylprolyl cis-trans isomerase
• PPIase
• Ptg-10
• rotamase
• T-cell FK506-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FKBP5