FKBP51/FKBP5 Antibody

Images

 
Western Blot: FKBP5/FKBP51 Antibody [NBP1-84677] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: ...read more
Immunocytochemistry/ Immunofluorescence: FKBP5/FKBP51 Antibody [NBP1-84677] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: FKBP5/FKBP51 Antibody [NBP1-84677] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

FKBP51/FKBP5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
FKBP51/FKBP5 Protein (NBP1-84677PEP)

Alternate Names for FKBP51/FKBP5 Antibody

  • 51 kDa FKBP
  • 54 kDa progesterone receptor-associated immunophilin
  • AIG6,51 kDa FK506-binding protein
  • Androgen-regulated protein 6
  • Dit1
  • FF1 antigen
  • FK506 binding protein 5
  • FK506-binding protein 5
  • FKBP5
  • FKBP-5
  • FKBP51
  • FKBP-51
  • FKBP51PPIase FKBP5
  • FKBP54
  • FKBP54EC 5.2.1.8
  • HSP90-binding immunophilin
  • MGC111006
  • p54
  • P54,51 kDa FK506-binding protein 5
  • peptidyl-prolyl cis-trans isomerase FKBP5
  • peptidylprolyl cis-trans isomerase
  • PPIase
  • Ptg-10
  • rotamase
  • T-cell FK506-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye, Am(-), Av(-), Pm(-)
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-15080
Species: Hu
Applications: WB, ICC/IF
MAB1776
Species: Hu, Mu, Rt
Applications: WB
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IP
NB300-508
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, IP
NB100-1556
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB8930
Species: Hu
Applications: WB, Simple Western, ICC
MAB18251
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-33049
Species: Hu
Applications: WB
MAB7670
Species: Hu
Applications: WB, ICC
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-84677
Species: Hu, Mouse, Rat
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FKBP5/FKBP51 Antibody (NBP1-84677) (0)

There are no publications for FKBP5/FKBP51 Antibody (NBP1-84677).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP5/FKBP51 Antibody (NBP1-84677) (0)

There are no reviews for FKBP5/FKBP51 Antibody (NBP1-84677). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FKBP5/FKBP51 Antibody (NBP1-84677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP51/FKBP5 Antibody Products

Related Products by Gene

Bioinformatics Tool for FKBP5/FKBP51 Antibody (NBP1-84677)

Discover related pathways, diseases and genes to FKBP5/FKBP51 Antibody (NBP1-84677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP5/FKBP51 Antibody (NBP1-84677)

Discover more about diseases related to FKBP5/FKBP51 Antibody (NBP1-84677).
 

Pathways for FKBP5/FKBP51 Antibody (NBP1-84677)

View related products by pathway.

PTMs for FKBP5/FKBP51 Antibody (NBP1-84677)

Learn more about PTMs related to FKBP5/FKBP51 Antibody (NBP1-84677).
 

Research Areas for FKBP5/FKBP51 Antibody (NBP1-84677)

Find related products by research area.

Blogs on FKBP51/FKBP5

There are no specific blogs for FKBP51/FKBP5, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol FKBP5
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-84677 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought