FKBP51/FKBP5 Antibody

Images

 
Western Blot: FKBP51/FKBP5 Antibody [NBP1-84676] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining in human breast and cerebral cortex tissues using anti-FKBP5 antibody. Corresponding FKBP5 RNA-seq data are presented for the same tissues.
Western Blot: FKBP51/FKBP5 Antibody [NBP1-84676] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: ...read more
Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human breast shows high expression.
Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human cerebral cortex shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FKBP51/FKBP5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNE
Specificity
Specificity of human, mouse, rat FKBP51/FKBP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FKBP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
FKBP51/FKBP5 Lysate (NBP2-65106)
Control Peptide
FKBP51/FKBP5 Protein (NBP1-84676PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FKBP51/FKBP5 Antibody

  • 51 kDa FKBP
  • 54 kDa progesterone receptor-associated immunophilin
  • AIG6,51 kDa FK506-binding protein
  • Androgen-regulated protein 6
  • Dit1
  • FF1 antigen
  • FK506 binding protein 5
  • FK506-binding protein 5
  • FKBP5
  • FKBP-5
  • FKBP51
  • FKBP-51
  • FKBP51PPIase FKBP5
  • FKBP54
  • FKBP54EC 5.2.1.8
  • HSP90-binding immunophilin
  • MGC111006
  • p54
  • P54,51 kDa FK506-binding protein 5
  • peptidyl-prolyl cis-trans isomerase FKBP5
  • peptidylprolyl cis-trans isomerase
  • PPIase
  • Ptg-10
  • rotamase
  • T-cell FK506-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-84675
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-191
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, IF
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-508
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, IP
NB100-1556
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, PLA, ICC
NBP2-24940
Species: Hu, Ye
Applications: WB
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB7670
Species: Hu
Applications: WB, ICC
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP

Publications for FKBP51/FKBP5 Antibody (NBP1-84676) (0)

There are no publications for FKBP51/FKBP5 Antibody (NBP1-84676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP51/FKBP5 Antibody (NBP1-84676) (0)

There are no reviews for FKBP51/FKBP5 Antibody (NBP1-84676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FKBP51/FKBP5 Antibody (NBP1-84676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional FKBP51/FKBP5 Products

Bioinformatics Tool for FKBP51/FKBP5 Antibody (NBP1-84676)

Discover related pathways, diseases and genes to FKBP51/FKBP5 Antibody (NBP1-84676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP51/FKBP5 Antibody (NBP1-84676)

Discover more about diseases related to FKBP51/FKBP5 Antibody (NBP1-84676).
 

Pathways for FKBP51/FKBP5 Antibody (NBP1-84676)

View related products by pathway.

PTMs for FKBP51/FKBP5 Antibody (NBP1-84676)

Learn more about PTMs related to FKBP51/FKBP5 Antibody (NBP1-84676).
 

Research Areas for FKBP51/FKBP5 Antibody (NBP1-84676)

Find related products by research area.

Blogs on FKBP51/FKBP5

There are no specific blogs for FKBP51/FKBP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP51/FKBP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP5
Entrez