FKBP51/FKBP5 Antibody


Western Blot: FKBP51/FKBP5 Antibody [NBP1-84676] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: more
Immunocytochemistry/ Immunofluorescence: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

FKBP51/FKBP5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FKBP51/FKBP5 Protein (NBP1-84676PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FKBP51/FKBP5 Antibody

  • 51 kDa FKBP
  • 54 kDa progesterone receptor-associated immunophilin
  • AIG6,51 kDa FK506-binding protein
  • Androgen-regulated protein 6
  • Dit1
  • FF1 antigen
  • FK506 binding protein 5
  • FK506-binding protein 5
  • FKBP5
  • FKBP-5
  • FKBP51
  • FKBP-51
  • FKBP51PPIase FKBP5
  • FKBP54
  • FKBP54EC
  • HSP90-binding immunophilin
  • MGC111006
  • p54
  • P54,51 kDa FK506-binding protein 5
  • peptidyl-prolyl cis-trans isomerase FKBP5
  • peptidylprolyl cis-trans isomerase
  • PPIase
  • Ptg-10
  • rotamase
  • T-cell FK506-binding protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IP

Publications for FKBP51/FKBP5 Antibody (NBP1-84676) (0)

There are no publications for FKBP51/FKBP5 Antibody (NBP1-84676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP51/FKBP5 Antibody (NBP1-84676) (0)

There are no reviews for FKBP51/FKBP5 Antibody (NBP1-84676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FKBP51/FKBP5 Antibody (NBP1-84676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FKBP51/FKBP5 Products

Bioinformatics Tool for FKBP51/FKBP5 Antibody (NBP1-84676)

Discover related pathways, diseases and genes to FKBP51/FKBP5 Antibody (NBP1-84676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP51/FKBP5 Antibody (NBP1-84676)

Discover more about diseases related to FKBP51/FKBP5 Antibody (NBP1-84676).

Pathways for FKBP51/FKBP5 Antibody (NBP1-84676)

View related products by pathway.

PTMs for FKBP51/FKBP5 Antibody (NBP1-84676)

Learn more about PTMs related to FKBP51/FKBP5 Antibody (NBP1-84676).

Research Areas for FKBP51/FKBP5 Antibody (NBP1-84676)

Find related products by research area.

Blogs on FKBP51/FKBP5

There are no specific blogs for FKBP51/FKBP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FKBP51/FKBP5 Antibody and receive a gift card or discount.


Gene Symbol FKBP5