FKBP51/FKBP5 Antibody - BSA Free

Western Blot: FKBP51/FKBP5 Antibody [NBP1-84676] - Analysis using Anti-FKBP5 antibody NBP1-84676 (A) shows similar pattern to independent antibody NBP1-84677 (B).

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: FKBP51/FKBP5 Antibody [NBP1-84676] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.

Staining of human cell line HEK 293 shows localization to nucleoplasm.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FKBP51/FKBP5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FKBP51/FKBP5 Antibody - BSA Free (NBP1-84676) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-FKBP51/FKBP5 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FKBP5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FKBP51/FKBP5 Protein (NBP1-84676PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FKBP51/FKBP5 Antibody - BSA Free

• 51 kDa FKBP
• 54 kDa progesterone receptor-associated immunophilin
• AIG6,51 kDa FK506-binding protein
• Androgen-regulated protein 6
• Dit1
• FF1 antigen
• FK506 binding protein 5
• FK506-binding protein 5
• FKBP5
• FKBP-5
• FKBP51
• FKBP-51
• FKBP51PPIase FKBP5
• FKBP54
• FKBP54EC 5.2.1.8
• HSP90-binding immunophilin
• MGC111006
• p54
• P54,51 kDa FK506-binding protein 5
• peptidyl-prolyl cis-trans isomerase FKBP5
• peptidylprolyl cis-trans isomerase
• PPIase
• Ptg-10
• rotamase
• T-cell FK506-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FKBP51/FKBP5 Antibody (NBP1-84676)(2)

Publications using NBP1-84676

• Kim MJ, Choi GE, Chae CW et al. Melatonin-mediated FKBP4 downregulation protects against stress-induced neuronal mitochondria dysfunctions by blocking nuclear translocation of GR Cell death & disease 2023-02-21 [PMID: 36810730] (WB, Human)
• Kwon HS, Kim YE, Park HH et al. Neuroprotective Effects of GV1001 in Animal Stroke Model and Neural Cells Subject to Oxygen-Glucose Deprivation/Reperfusion Injury Journal of Stroke 2021-09-30 [PMID: 34649386] (Western Blot)

Bioinformatics

• Gene Symbol: FKBP5