Filensin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Filensin Antibody [NBP1-91902] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: Filensin Antibody [NBP1-91902] - Staining of human kidney.

Immunohistochemistry-Paraffin: Filensin Antibody [NBP1-91902] - Staining of human eye shows moderate cytoplasmic positivity in the lens.

Immunohistochemistry-Paraffin: Filensin Antibody [NBP1-91902] - Staining of human eye, kidney, lymph node and testis using Anti-BFSP1 antibody NBP1-91902 (A) shows similar protein distribution across tissues to independent antibody NBP1-91903 (B).

Immunohistochemistry-Paraffin: Filensin Antibody [NBP1-91902] - Staining of human testis.

Immunohistochemistry-Paraffin: Filensin Antibody [NBP1-91902] - Staining of human lymph node.

Staining of human lymph node shows no positivity in non-germinal center cells.

Staining of human kidney shows no cytoplasmic positivity in cells in tubules.

Staining of human eye shows moderate cytoplasmic positivity in lens fiber cells.

Staining of human eye).

Staining of human testis shows no positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Filensin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Filensin Antibody - BSA Free (NBP1-91902) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SAHECHDDEIQLYNEQIETLRKEIEETERVLEKSSYDCRQLAVAQQTLKNELDRYHRIIEIEGNRLTSAFIETPIPLFTQSHGVSLSTGSGGKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BFSP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Knockdown Validated
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Filensin Protein (NBP1-91902PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Filensin Antibody - BSA Free

• Beaded filament structural protein 1
• beaded filament structural protein 1, filensin
• CP115Lens intermediate filament-like heavy
• filensin
• Lens fiber cell beaded-filament structural protein CP 115
• LIFL-H115 KD

Background

More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and filensin (or CP115), are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BFSP1