Recombinant Human Filamin B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Filamin B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human FLNB partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FLNB

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Filamin B Protein

  • ABP-278filamin B, beta (actin binding protein 278)
  • ABP-280 homolog
  • actin binding protein 278
  • Actin-binding-like protein
  • AOI
  • beta-filamin
  • DKFZp686O033
  • FH1
  • filamin B, beta
  • Filamin homolog 1
  • filamin-3
  • filamin-B
  • FLN1L
  • FLN3
  • FLN-B
  • Larsen syndrome 1 (autosomal dominant)
  • LRS1
  • SCT
  • TABPABP-280
  • TAPDKFZp686A1668
  • Thyroid autoantigen
  • Truncated ABP
  • Truncated actin-binding protein

Background

FLNB - filamin B, beta (actin binding protein 278)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01817
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC

Publications for Filamin B Partial Recombinant Protein (H00002317-Q01) (0)

There are no publications for Filamin B Partial Recombinant Protein (H00002317-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Filamin B Partial Recombinant Protein (H00002317-Q01) (0)

There are no reviews for Filamin B Partial Recombinant Protein (H00002317-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Filamin B Partial Recombinant Protein (H00002317-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Filamin B Products

Bioinformatics Tool for Filamin B Partial Recombinant Protein (H00002317-Q01)

Discover related pathways, diseases and genes to Filamin B Partial Recombinant Protein (H00002317-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Filamin B Partial Recombinant Protein (H00002317-Q01)

Discover more about diseases related to Filamin B Partial Recombinant Protein (H00002317-Q01).
 

Pathways for Filamin B Partial Recombinant Protein (H00002317-Q01)

View related products by pathway.

PTMs for Filamin B Partial Recombinant Protein (H00002317-Q01)

Learn more about PTMs related to Filamin B Partial Recombinant Protein (H00002317-Q01).

Blogs on Filamin B

There are no specific blogs for Filamin B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Filamin B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FLNB