Fibronectin Recombinant Protein Antigen

Images

 
There are currently no images for Fibronectin Recombinant Protein Antigen (NBP1-84468PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Fibronectin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FN1.

Source: E. coli

Amino Acid Sequence: HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84468.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fibronectin Recombinant Protein Antigen

  • CIG
  • ED-B
  • fibronectin 1
  • Fibronectin
  • FINC
  • FN
  • FN1
  • FNZ
  • GFND
  • GFND2
  • LETS
  • MSF
  • SMDCF

Background

Fibronectin (also known as FN1, or Fibronectin 1) is an extracellular matrix glycoprotein that binds to integrins and has a large role in cell adhesion, migration, differentiation, and growth. It plays a key role in wound healing by helping form blood clots and participates in embryonic development by guiding cell attachment and migration. Fibronectin consists of two monomers linked by disulfide bonds and binds extracellular components such as collagen fibrin and syndecans. Fibronectin has been implicated in carcinoma and tumor development while also limiting tumor cells response to treatment. Novus offers Fibronectin antibodies, ELISA Kits, lysates, and proteins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

2308-VN
Species: Hu
Applications: BA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
M6000B
Species: Mu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-84468PEP
Species: Hu
Applications: AC

Publications for Fibronectin Recombinant Protein Antigen (NBP1-84468PEP) (0)

There are no publications for Fibronectin Recombinant Protein Antigen (NBP1-84468PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibronectin Recombinant Protein Antigen (NBP1-84468PEP) (0)

There are no reviews for Fibronectin Recombinant Protein Antigen (NBP1-84468PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fibronectin Recombinant Protein Antigen (NBP1-84468PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fibronectin Products

Research Areas for Fibronectin Recombinant Protein Antigen (NBP1-84468PEP)

Find related products by research area.

Blogs on Fibronectin.

Nickel induces migratory and invasive phenotype in human epithelial cells by epigenetically activating ZEB1
By Jamshed Arslan Pharm.D. Nickel (Ni) is a naturally abundant metallic element. It is a major component of stainless steel, coins, and many other items of daily use. Disturbingly, Ni exposure is associated with can...  Read full blog post.

Bad news for stomach cancer: BAMBI protein inhibits gastric carcinoma via TGF-beta/epithelial-mesenchymal transition signaling
By Jamshed Arslan Pharm.D. Gastric carcinoma is the second leading cause of cancer-related deaths worldwide. One of the key features of gastric carcinoma is acidosis, which promotes growth and metastasis of gastric ...  Read full blog post.

Alpha-smooth muscle actin and the modulation of endothelial and epithelial cell biology
Actin is essential for a wide range of cell functions, ranging from cell division and chromatin remodeling to vesicle trafficking and maintenance of cellular structure. In fact, mislocalization of actin to cell junctions during development leads t...  Read full blog post.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Fibronectin: Organizing Cell Activity across the ECM
Fibronectin is a glycoprotein found in the extracellular matrix (ECM) that binds to integrins and other components of the ECM such as collagen and fibrin. Under normal physiological conditions, fibronectin is an important factor in cell adhesion, grow...  Read full blog post.

Using the Laminin Antibody in Angiogenesis Research
Laminin is one of a large number of proteins expressed on the basal laminar of the ECM (extracellular matrix). The laminin antibody database covers several proteins, which interact with integrins and other receptor proteins to support cellular differe...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fibronectin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FN1