FGL2/Fibroleukin Antibody (5A10) Summary
Immunogen |
FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG |
Specificity |
FGL2 - fibrinogen-like 2 (5A10) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
FGL2 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Flow Cytometry
- Western Blot 1:500
|
Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for FGL2/Fibroleukin Antibody (5A10)
Background
The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Publications for FGL2/Fibroleukin Antibody (H00010875-M02) (0)
There are no publications for FGL2/Fibroleukin Antibody (H00010875-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FGL2/Fibroleukin Antibody (H00010875-M02) (0)
There are no reviews for FGL2/Fibroleukin Antibody (H00010875-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FGL2/Fibroleukin Antibody (H00010875-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FGL2/Fibroleukin Products
Bioinformatics Tool for FGL2/Fibroleukin Antibody (H00010875-M02)
Discover related pathways, diseases and genes to FGL2/Fibroleukin Antibody (H00010875-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for FGL2/Fibroleukin Antibody (H00010875-M02)
Discover more about diseases related to FGL2/Fibroleukin Antibody (H00010875-M02).
| | Pathways for FGL2/Fibroleukin Antibody (H00010875-M02)
View related products by pathway.
|
PTMs for FGL2/Fibroleukin Antibody (H00010875-M02)
Learn more about PTMs related to FGL2/Fibroleukin Antibody (H00010875-M02).
| | Research Areas for FGL2/Fibroleukin Antibody (H00010875-M02)
Find related products by research area.
|
Blogs on FGL2/Fibroleukin